StarFunc result for job id Q96QR8

User Input

>input (312 residues)
MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLK
IAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALK
SEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLI
EFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNK
YGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGG
GEESEGEEVDED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35295	0.895	0.863	5.092E-50	324	0.981	0.944	O35295.pdb.gz	PURB_MOUSE Transcriptional activator protein Pur-beta OS=Mus musculus OX=10090 GN=Purb PE=1 SV=3
2	AFDB:Q00577	0.521	0.506	2.006E-35	322	0.654	0.634	Q00577.pdb.gz	PURA_HUMAN Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2
3	AFDB:Q6JIZ2	0.493	0.534	4.059E-35	287	0.683	0.742	Q6JIZ2.pdb.gz	Q6JIZ2_DANRE Pur-alpha OS=Danio rerio OX=7955 GN=pura PE=1 SV=1
4	AFDB:Q8R4E6	0.491	0.443	1.626E-29	350	0.538	0.480	Q8R4E6.pdb.gz	PURG_MOUSE Purine-rich element-binding protein gamma OS=Mus musculus OX=10090 GN=Purg PE=1 SV=1
5	AFDB:Q9V4D9	0.487	0.549	1.246E-25	275	0.404	0.458	Q9V4D9.pdb.gz	Q9V4D9_DROME Purine-rich binding protein-alpha, isoform B OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=3 SV=2
6	AFDB:Q94230	0.439	0.593	7.921E-19	226	0.269	0.372	Q94230.pdb.gz	PLP1_CAEEL Transcriptional activator plp-1 OS=Caenorhabditis elegans OX=6239 GN=plp-1 PE=1 SV=1
7	AFDB:Q9SKZ1	0.390	0.410	3.242E-18	296	0.269	0.284	Q9SKZ1.pdb.gz	PUR_ARATH Transcription factor Pur-alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PURA1 PE=1 SV=2
8	AFDB:Q66GR6	0.247	0.278	9.226E-4	268	0.077	0.090	Q66GR6.pdb.gz	WHY3_ARATH Single-stranded DNA-binding protein WHY3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=WHY3 PE=1 SV=1
9	AFDB:Q585U3	0.142	0.072	1.423E-3	702	0.077	0.034	Q585U3.pdb.gz	Q585U3_TRYB2 Trans-sialidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.90 PE=4 SV=1
10	AFDB:A0A1D8PIX3	0.129	0.071	1.675E-3	696	0.090	0.040	A0A1D8PIX3.pdb.gz	A0A1D8PIX3_CANAL Utp8p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTP8 PE=4 SV=1
11	PDB:2gjeD	0.188	0.320	2.101E-2	147	0.061	0.129	2gjeD.pdb.gz	Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
12	PDB:3cm1A	0.191	0.358	3.613E-2	137	0.042	0.095	3cm1A.pdb.gz
13	PDB:7r5jK0	0.122	0.041	5.002E-2	1086	0.083	0.024	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:4xmhA	0.116	0.176	9.080E-2	185	0.029	0.049	4xmhA.pdb.gz	Structure and dynamics of the membrane attaching nitric oxide transporter nitrophorin 7.
15	PDB:7r5jR0	0.120	0.035	9.080E-2	1399	0.080	0.018	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:7lsyH	0.130	0.167	1.128E-1	223	0.042	0.058	7lsyH.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
17	PDB:1xi4A	0.131	0.034	1.191E-1	1630	0.058	0.011	1xi4A.pdb.gz
18	PDB:5jowA	0.127	0.081	1.257E-1	504	0.080	0.050	5jowA.pdb.gz
19	PDB:7ayqA	0.129	0.062	1.257E-1	808	0.087	0.033	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.
20	PDB:7pi3A	0.112	0.107	1.401E-1	328	0.058	0.055	7pi3A.pdb.gz	Heterotypic interactions drive antibody synergy against a malaria vaccine candidate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68A21	0.0	589	315	0.981	0.971	PURB_RAT Transcriptional activator protein Pur-beta OS=Rattus norvegicus OX=10116 GN=Purb PE=1 SV=3
2	Q96QR8	0.0	613	312	1.000	1.000	PURB_HUMAN Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3
3	O35295	2.68e-172	482	324	0.978	0.941	PURB_MOUSE Transcriptional activator protein Pur-beta OS=Mus musculus OX=10090 GN=Purb PE=1 SV=3
4	Q6JIZ2	1.74e-138	395	287	0.670	0.728	Q6JIZ2_DANRE Pur-alpha OS=Danio rerio OX=7955 GN=pura PE=1 SV=1
5	P42669	8.14e-135	387	321	0.622	0.604	PURA_MOUSE Transcriptional activator protein Pur-alpha OS=Mus musculus OX=10090 GN=Pura PE=1 SV=1
6	Q00577	9.61e-135	387	322	0.622	0.602	PURA_HUMAN Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2
7	Q9UJV8	2.07e-98	295	347	0.535	0.481	PURG_HUMAN Purine-rich element-binding protein gamma OS=Homo sapiens OX=9606 GN=PURG PE=2 SV=1
8	Q8R4E6	5.26e-98	294	350	0.535	0.477	PURG_MOUSE Purine-rich element-binding protein gamma OS=Mus musculus OX=10090 GN=Purg PE=1 SV=1
9	F3YDK4	9.02e-76	234	259	0.397	0.479	F3YDK4_DROME Purine-rich binding protein-alpha, isoform G OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=2 SV=1
10	Q95RR6	1.36e-75	234	274	0.410	0.467	Q95RR6_DROME LD15002p OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=1 SV=1
11	Q8IMC4	1.41e-75	234	260	0.397	0.477	Q8IMC4_DROME Purine-rich binding protein-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=3 SV=1
12	Q9V4D9	2.01e-75	234	275	0.410	0.465	Q9V4D9_DROME Purine-rich binding protein-alpha, isoform B OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=3 SV=2
13	O16860	2.96e-69	218	274	0.397	0.453	O16860_DROME Pur-alpha OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=2 SV=1
14	P86252	3.12e-50	165	138	0.356	0.804	PURA_RAT Transcriptional activator protein Pur-alpha (Fragments) OS=Rattus norvegicus OX=10116 GN=Pura PE=1 SV=1
15	Q94230	6.54e-32	120	226	0.269	0.372	PLP1_CAEEL Transcriptional activator plp-1 OS=Caenorhabditis elegans OX=6239 GN=plp-1 PE=1 SV=1
16	Q9SKZ1	2.37e-19	88.6	296	0.247	0.260	PUR_ARATH Transcription factor Pur-alpha 1 OS=Arabidopsis thaliana OX=3702 GN=PURA1 PE=1 SV=2
17	P63883	9.7	30.4	417	0.061	0.046	AMIC_ECOLI N-acetylmuramoyl-L-alanine amidase AmiC OS=Escherichia coli (strain K12) OX=83333 GN=amiC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11680 DUF3276	22	16.6	Protein of unknown function (DUF3276)
2	PF04845 PurA	5.8e-95	328.3	PurA ssDNA and RNA-binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332706	0.938	Transcriptional activator protein Pur-alpha
2	9606.ENSP00000406046	0.792	DNA polymerase delta catalytic subunit
3	9606.ENSP00000379644	0.764	Transcription factor SOX-6
4	9606.ENSP00000368349	0.762	DNA polymerase alpha catalytic subunit
5	9606.ENSP00000480987	0.748	DNA replication licensing factor MCM3
6	9606.ENSP00000262873	0.736	Myosin-7B
7	9606.ENSP00000363017	0.732	Replication protein A 32 kDa subunit
8	9606.ENSP00000223129	0.730	Replication protein A 14 kDa subunit
9	9606.ENSP00000254719	0.729	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000480186	0.722	DNA polymerase delta subunit 2
11	9606.ENSP00000369411	0.721	Replication factor C subunit 3
12	9606.ENSP00000263681	0.720	DNA polymerase delta subunit 3
13	9606.ENSP00000265465	0.720	DNA polymerase alpha subunit B
14	9606.ENSP00000307143	0.720	Protein downstream neighbor of Son
15	9606.ENSP00000362131	0.720	Replication protein A 30 kDa subunit
16	9606.ENSP00000368458	0.720	Proliferating cell nuclear antigen
17	9606.ENSP00000225388	0.696	Nuclear fragile X mental retardation-interacting protein 2
18	9606.ENSP00000346067	0.695	40S ribosomal protein SA
19	9606.ENSP00000386041	0.571	Myosin-6
20	9606.ENSP00000418983	0.571	Uncharacterized protein C6orf222

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	1.000	double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0003697	0.989	single-stranded DNA binding
GO:0003729	0.929	mRNA binding
GO:1990837	0.867	sequence-specific double-stranded DNA binding
GO:0000976	0.826	transcription cis-regulatory region binding
GO:0046332	0.527	SMAD binding
GO:0140110	0.518	transcription regulator activity
GO:0008134	0.507	transcription factor binding
GO:0003700	0.498	DNA-binding transcription factor activity
GO:0140297	0.495	DNA-binding transcription factor binding
GO:0001227	0.488	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.390	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051253	0.986	negative regulation of RNA metabolic process
GO:0045892	0.984	negative regulation of DNA-templated transcription
GO:0009987	0.487	cellular process
GO:0071704	0.323	organic substance metabolic process
GO:0044238	0.320	primary metabolic process
GO:0044237	0.319	cellular metabolic process
GO:0006807	0.317	nitrogen compound metabolic process
GO:0043170	0.312	macromolecule metabolic process
GO:0034641	0.308	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.956	nucleoplasm
GO:0043232	0.332	intracellular non-membrane-bounded organelle
GO:0032991	0.301	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]