StarFunc result for job id Q96QT4

User Input

>input (1865 residues)
MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAM
KYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEVI
LQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGV
AKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNN
LHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTV
LEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNE
ALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRV
DIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNT
KQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSL
GGNNRRSGRNTSSSTPQLRKSHESFGNRADKKEKMRHNHFIKTAQPYRPKIDTVMEEGKK
KRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYR
SMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNST
CLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKTKA
EMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLP
ITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEK
VREIFMSEAGKVNQKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVA
GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKA
ILYPHEAPSWTLAKDIVFHPYWMIFGEVYAYEIDVCANDSVIPQICGPGTWLTPFLQAVY
LFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVS
LFCCICKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVT
FERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV
HNEITRELSISKHLAQNLIDDGPVRPSVWKKHGVVNTLSSSLPQGDLESNNPFHCNILMK
DDKDPQCNIFGQDLPAVPQRKEFNFPEAGSSSGALFPSAVSPPELRQRLHGVELLKIFNK
NQKLGSSSTSIPHLSSPPTKFFVSTPSQPSCKSHLETGTKDQETVCSKATEGDNTEFGAF
VGHRDSMDLQRFKETSNKIKILSNNNTSENTLKRVSSLAGFTDCHRTSIPVHSKQAEKIS
RRPSTEDTHEVDSKAALIPDWLQDRPSNREMPSEEGTLNGLTSPFKPAMDTNYYYSAVER
NNLMRLSQSIPFTPVPPRGEPVTVYRLEESSPNILNNSMSSWSQLGLCAKIEFLSKEEMG
GGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVVNTWSSIYKEDTVLHLCLREIQQQRA
AQKLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIP
TNTLEEIMLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIKAEEKRSCDMVFGPANLGE
DAIKNFRAKHHCNSCCRKLKLPDLKRNDYTPDKIIFPQDEPSDLNLQPGNSTKESESTNS
VRLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TV84	0.582	0.666	0.000	1622	0.391	0.450	Q2TV84.pdb.gz	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
2	AFDB:Q7Z4N2	0.571	0.661	0.000	1603	0.388	0.452	Q7Z4N2.pdb.gz	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
3	AFDB:Q8CIR4	0.621	0.575	0.000	2028	0.545	0.501	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
4	AFDB:Q96QT4	1.000	1.000	0.000	1865	1.000	1.000	Q96QT4.pdb.gz	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
5	AFDB:Q9BX84	0.648	0.602	0.000	2022	0.555	0.512	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
6	AFDB:Q9HCF6	0.589	0.632	0.000	1732	0.416	0.447	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
7	AFDB:Q20766	0.531	0.693	1.161E-87	1406	0.239	0.317	Q20766.pdb.gz	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
8	PDB:6co7A	0.497	0.857	7.541E-68	1061	0.194	0.340	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
9	PDB:6puuA	0.478	0.667	3.789E-60	1309	0.186	0.264	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
10	PDB:6drjA	0.421	0.587	3.382E-52	1266	0.174	0.256	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
11	PDB:6bcqB	0.432	0.767	1.897E-51	983	0.166	0.314	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
12	PDB:6bqrA	0.426	0.789	2.153E-49	948	0.156	0.307	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
13	PDB:6pkxB	0.412	0.600	2.243E-48	1218	0.172	0.263	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
14	PDB:6mj2A	0.442	0.592	3.649E-48	1337	0.183	0.255	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
15	PDB:5wp6A	0.419	0.745	1.307E-45	977	0.161	0.307	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
16	PDB:7wrbA	0.399	0.748	3.029E-45	930	0.143	0.286	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.
17	PDB:8e4nA	0.389	0.753	4.314E-45	901	0.144	0.299	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
18	AFDB:P27732	0.105	0.092	1.601E-6	2203	0.093	0.079	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
19	AFDB:Q80WE4	0.044	0.045	2.068E-3	1774	0.081	0.085	Q80WE4.pdb.gz	KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3
20	AFDB:H8ESG1	0.048	0.058	4.583E-3	1494	0.062	0.078	H8ESG1.pdb.gz	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7T1N0	0.0	652	1551	0.220	0.265	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
2	A8DYE2	0.0	1054	2023	0.292	0.269	TRPCG_DROME Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1
3	G5EE91	0.0	637	1931	0.194	0.187	G5EE91_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
4	G5EGP7	0.0	637	1971	0.194	0.183	G5EGP7_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
5	Q20766	0.0	736	1406	0.248	0.329	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
6	Q2TV84	0.0	834	1622	0.235	0.270	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
7	Q563W7	0.0	2683	1774	0.716	0.753	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
8	Q7Z4N2	0.0	837	1603	0.236	0.275	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
9	Q8CIR4	0.0	1499	2028	0.401	0.369	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
10	Q923J1	0.0	3694	1863	0.943	0.944	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
11	Q925B3	0.0	3677	1862	0.938	0.939	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
12	Q93971	0.0	637	2032	0.194	0.178	TRPG_CAEEL Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4
13	Q96QT4	0.0	3905	1865	1.000	1.000	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
14	Q9BX84	0.0	1523	2022	0.408	0.376	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
15	Q9HCF6	0.0	1491	1732	0.396	0.427	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
16	G5ECM4	1.10e-172	572	1694	0.162	0.178	G5ECM4_CAEEL GTL-1 OS=Caenorhabditis elegans OX=6239 GN=gtl-1 PE=1 SV=1
17	G5EGJ6	7.52e-169	560	1626	0.169	0.194	G5EGJ6_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
18	A0A0R4IMY7	2.21e-140	477	1470	0.189	0.239	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
19	E9PTA2	1.32e-133	458	1507	0.208	0.257	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
20	Q91YD4	3.20e-133	457	1506	0.182	0.226	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02816 Alpha_kinase	4e-41	152.7	Alpha-kinase family
2	PF00520 Ion_trans	3.2e-05	34.9	Ion transport protein
3	PF18139 LSDAT_euk	1.8e-115	396.5	SLOG in TRPM
4	PF18171 LSDAT_prok	2.1e-15	68.0	SLOG in TRPM, prokaryote
5	PF16519 TRPM_tetra	1.8e-20	84.1	Tetramerisation domain of TRPM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320239

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342222	0.954	Transient receptor potential cation channel subfamily V member 2
2	9606.ENSP00000308351	0.906	Mixed lineage kinase domain-like protein
3	9606.ENSP00000354006	0.858	Transient receptor potential cation channel subfamily M member 6
4	9606.ENSP00000419313	0.844	Short transient receptor potential channel 1
5	9606.ENSP00000381023	0.841	Transient receptor potential cation channel subfamily M member 2
6	9606.ENSP00000370744	0.822	Inositol 1,4,5-trisphosphate receptor type 2
7	9606.ENSP00000338185	0.804	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
8	9606.ENSP00000406191	0.799	Transient receptor potential cation channel subfamily V member 4
9	9606.ENSP00000459962	0.788	Transient receptor potential cation channel, subfamily V, member 1
10	9606.ENSP00000461007	0.788	Transient receptor potential cation channel subfamily V member 1
11	9606.ENSP00000352358	0.773	Transient receptor potential cation channel subfamily V member 6
12	9606.ENSP00000356105	0.767	Solute carrier family 41 member 1
13	9606.ENSP00000265310	0.756	Transient receptor potential cation channel subfamily V member 5
14	9606.ENSP00000262209	0.752	Transient receptor potential cation channel subfamily A member 1
15	9606.ENSP00000258538	0.743	Solute carrier family 41 member 2
16	9606.ENSP00000354649	0.742	Magnesium transporter protein 1
17	9606.ENSP00000301365	0.714	Transient receptor potential cation channel subfamily V member 3
18	9606.ENSP00000295987	0.713	Synapsin-1
19	9606.ENSP00000264079	0.690	Mucolipin-1
20	9606.ENSP00000478059	0.674	Stromal interaction molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	0.999	calcium channel activity
GO:0005488	0.983	binding
GO:0005515	0.969	protein binding
GO:0003824	0.619	catalytic activity
GO:1901363	0.306	heterocyclic compound binding
GO:0097159	0.306	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.995	localization
GO:0009987	0.994	cellular process
GO:0030001	0.988	metal ion transport
GO:0050789	0.950	regulation of biological process
GO:0006816	0.950	calcium ion transport
GO:0050794	0.901	regulation of cellular process
GO:0050896	0.754	response to stimulus
GO:0098662	0.729	inorganic cation transmembrane transport
GO:0098655	0.729	monoatomic cation transmembrane transport
GO:0032501	0.678	multicellular organismal process
GO:0008152	0.631	metabolic process
GO:0098771	0.579	inorganic ion homeostasis
GO:0055080	0.577	monoatomic cation homeostasis
GO:0070588	0.567	calcium ion transmembrane transport
GO:0071704	0.537	organic substance metabolic process
GO:0003008	0.518	system process
GO:0010960	0.474	magnesium ion homeostasis
GO:0048518	0.428	positive regulation of biological process
GO:0044237	0.418	cellular metabolic process
GO:0048522	0.388	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.631	intracellular membrane-bounded organelle
GO:0005737	0.603	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]