StarFunc result for job id Q96QT6

User Input

>input (1004 residues)
MWEKMETKTIVYDLDTSGGLMEQIQALLAPPKTDEAEKRSRKPEKEPRRSGRATNHDSCD
SCKEGGDLLCCDHCPAAFHLQCCNPPLSEEMLPPGEWMCHRCTVRRKKREQKKELGHVNG
LVDKSGKRTTSPSSDTDLLDRSASKTELKAIAHARILERRASRPGTPTSSASTETPTSEQ
NDVDEDIIDVDEEPVAAEPDYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGS
SKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQCDYCPLLFHMDC
LEPPLTAMPLGRWMCPNHIEHVVLNQKNMTLSNRCQVFDRFQDTVSQHVVKVDFLNRIHK
KHPPNRRVLQSVKRRSLKVPDAIKSQYQFPPPLIAPAAIRDGELICNGIPEESQMHLLNS
EHLATQAEQQEWLCSVVALQCSILKHLSAKQMPSHWDSEQTEKADIKPVIVTDSSVTTSL
QTADKTPTPSHYPLSCPSGISTQNSLSCSPPHQSPALEDIGCSSCAEKSKKTPCGTANGP
VNTEVKANGPHLYSSPTDSTDPRRLPGANTPLPGLSHRQGWPRPLTPPAAGGLQNHTVGI
IVKTENATGPSSCPQRSLVPVPSLPPSIPSSCASIENTSTLQRKTVQSQIGPPLTDSRPL
GSPPNATRVLTPPQAAGDGILATTANQRFSSPAPSSDGKVSPGTLSIGSALTVPSFPANS
TAMVDLTNSLRAFMDVNGEIEINMLDEKLIKFLALQRIHQLFPSRVQPSPGSVGTHQLAS
GGHHIEVQRKEVQARAVFYPLLGLGGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKH
ACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQK
QDEEPSEEAAMMSSQAQGPQRRPCNCKASSSSLIGGSGAGWEGTALLHHGSYIKLGCLQF
VFSITEFATKQPKGDASLLQDGVLAEKLSLKPHQGPVLRSNSVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QT6	1.000	1.000	0.000	1004	1.000	1.000	Q96QT6.pdb.gz	PHF12_HUMAN PHD finger protein 12 OS=Homo sapiens OX=9606 GN=PHF12 PE=1 SV=2
2	AFDB:F4KE59	0.063	0.052	5.327E-6	1311	0.151	0.116	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
3	PDB:2ff4A	0.088	0.227	9.743E-6	379	0.024	0.063	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
4	AFDB:E7FDR0	0.050	0.052	7.482E-4	944	0.124	0.131	E7FDR0.pdb.gz	E7FDR0_DANRE Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Danio rerio OX=7955 GN=wu:fd15a05 PE=4 SV=1
5	PDB:7dvqX	0.082	0.465	1.368E-3	156	0.025	0.160	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
6	AFDB:Q96T23	0.062	0.045	1.849E-3	1441	0.094	0.065	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2
7	AFDB:Q9VQU9	0.061	0.079	3.589E-3	744	0.108	0.145	Q9VQU9.pdb.gz	BOWEL_DROME Protein bowel OS=Drosophila melanogaster OX=7227 GN=bowl PE=1 SV=1
8	AFDB:Q9STM3	0.047	0.038	4.301E-3	1360	0.097	0.071	Q9STM3.pdb.gz	REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana OX=3702 GN=REF6 PE=1 SV=1
9	PDB:5gm6U	0.086	0.423	6.180E-3	176	0.026	0.148	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	AFDB:Q2EI20	0.049	0.050	7.860E-3	855	0.103	0.120	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
11	AFDB:Q6DR99	0.036	0.046	1.000E-2	700	0.117	0.167	Q6DR99.pdb.gz	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
12	PDB:2kb3A	0.086	0.544	1.063E-2	143	0.025	0.175	2kb3A.pdb.gz
13	AFDB:A4D0Q3	0.051	0.062	1.129E-2	759	0.113	0.149	A4D0Q3.pdb.gz	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
14	PDB:2kfuA	0.085	0.442	1.622E-2	162	0.028	0.173	2kfuA.pdb.gz
15	AFDB:Q21227	0.040	0.036	1.721E-2	1188	0.102	0.086	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
16	PDB:5z56X	0.064	0.340	1.052E-1	159	0.016	0.101	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:6l9wD	0.071	0.414	3.963E-1	142	0.018	0.127	6l9wD.pdb.gz
18	PDB:1sgoA	0.034	0.135	1.173	139	0.016	0.115	1sgoA.pdb.gz
19	PDB:6p7eC	0.023	0.034	1.406	672	0.007	0.010	6p7eC.pdb.gz	Combined Solution and Crystal Methods Reveal the Electrostatic Tethers That Provide a Flexible Platform for Replication Activities in the Bacteriophage T7 Replisome.
20	PDB:1sksA	0.023	0.033	1.685	681	0.007	0.010	1sksA.pdb.gz	Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SPL2	0.0	1908	1003	0.959	0.960	PHF12_MOUSE PHD finger protein 12 OS=Mus musculus OX=10090 GN=Phf12 PE=1 SV=1
2	Q96QT6	0.0	2075	1004	1.000	1.000	PHF12_HUMAN PHD finger protein 12 OS=Homo sapiens OX=9606 GN=PHF12 PE=1 SV=2
3	Q9W410	3.71e-72	259	878	0.154	0.177	Q9W410_DROME GH06635p OS=Drosophila melanogaster OX=7227 GN=PF1 PE=1 SV=2
4	Q1LYP4	2.95e-12	73.6	1929	0.033	0.017	Q1LYP4_DANRE DNA helicase OS=Danio rerio OX=7955 GN=im:7143343 PE=1 SV=1
5	A2A8L1	5.97e-12	72.8	1946	0.028	0.014	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1
6	D3ZD32	6.07e-12	72.8	1948	0.028	0.014	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
7	Q8TDI0	6.44e-12	72.8	1954	0.028	0.014	CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1
8	A0A2R8Y425	1.11e-11	72.0	1889	0.027	0.014	A0A2R8Y425_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
9	A0A2R8Y521	1.21e-11	71.6	1920	0.027	0.014	A0A2R8Y521_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
10	A0A2R8YFD8	1.21e-11	71.6	1903	0.027	0.014	A0A2R8YFD8_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
11	F5GWX5	1.21e-11	71.6	1905	0.027	0.014	F5GWX5_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
12	A0A2R8Y212	1.22e-11	71.6	1914	0.027	0.014	A0A2R8Y212_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
13	A0A2U3TZM0	1.22e-11	71.6	1902	0.027	0.014	A0A2U3TZM0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
14	Q14839	1.22e-11	71.6	1912	0.027	0.014	CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2
15	A0A2R8Y5J0	1.26e-11	71.6	1892	0.027	0.014	A0A2R8Y5J0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
16	A0A2R8YFK9	1.26e-11	71.6	1899	0.027	0.014	A0A2R8YFK9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
17	A0A0C4DGG9	1.29e-11	71.6	1937	0.027	0.014	A0A0C4DGG9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
18	Q6PDQ2	1.30e-11	71.6	1915	0.027	0.014	CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus OX=10090 GN=Chd4 PE=1 SV=1
19	A0A8I6ACF8	1.33e-11	71.6	1899	0.027	0.014	A0A8I6ACF8_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=1
20	E9PU01	1.39e-11	71.6	1928	0.027	0.014	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	11	17.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00498 FHA	2	20.2	FHA domain
3	PF00628 PHD	2.2e-11	54.8	PHD-finger
4	PF13831 PHD_2	4.9e+02	11.6	PHD-finger
5	PF16737 PHF12_MRG_bd	3.5e-15	66.8	PHD finger protein 12 MRG binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331310	0.999	Mortality factor 4-like protein 1
2	9606.ENSP00000378402	0.999	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000362649	0.994	Histone deacetylase 1
4	9606.ENSP00000369131	0.994	Paired amphipathic helix protein Sin3b
5	9606.ENSP00000430432	0.994	Histone deacetylase 2
6	9606.ENSP00000394417	0.982	Mortality factor 4-like protein 2
7	9606.ENSP00000382688	0.958	Lysine-specific demethylase 5A
8	9606.ENSP00000307183	0.947	Inhibitor of growth protein 2
9	9606.ENSP00000369424	0.934	Histone-binding protein RBBP7
10	9606.ENSP00000287957	0.930	GATA zinc finger domain-containing protein 1
11	9606.ENSP00000337477	0.917	SIN3-HDAC complex-associated factor
12	9606.ENSP00000433205	0.908	BRCA2-interacting transcriptional repressor EMSY
13	9606.ENSP00000443988	0.904	Sin3 histone deacetylase corepressor complex component SDS3
14	9606.ENSP00000362592	0.867	Histone-binding protein RBBP4
15	9606.ENSP00000264183	0.848	AT-rich interactive domain-containing protein 4B
16	9606.ENSP00000302967	0.839	Histone deacetylase 3
17	9606.ENSP00000347602	0.825	AT-rich interactive domain-containing protein 4A
18	9606.ENSP00000312244	0.809	Male-specific lethal 3 homolog
19	9606.ENSP00000216807	0.792	Breast cancer metastasis-suppressor 1-like protein
20	9606.ENSP00000364929	0.781	Inhibitor of growth protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003712	0.927	transcription coregulator activity
GO:0005543	0.925	phospholipid binding
GO:0035091	0.922	phosphatidylinositol binding
GO:0003714	0.915	transcription corepressor activity
GO:0008134	0.833	transcription factor binding
GO:0001221	0.735	transcription coregulator binding
GO:0001222	0.734	transcription corepressor binding
GO:0097159	0.336	organic cyclic compound binding
GO:0003824	0.310	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045892	0.991	negative regulation of DNA-templated transcription
GO:0006357	0.989	regulation of transcription by RNA polymerase II
GO:0000122	0.974	negative regulation of transcription by RNA polymerase II
GO:0009987	0.630	cellular process
GO:0071704	0.351	organic substance metabolic process
GO:0044238	0.317	primary metabolic process
GO:0006807	0.309	nitrogen compound metabolic process
GO:0043170	0.302	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0000118	0.997	histone deacetylase complex
GO:0005667	0.991	transcription regulator complex
GO:0070822	0.988	Sin3-type complex
GO:0017053	0.961	transcription repressor complex
GO:0016580	0.694	Sin3 complex
GO:1990234	0.325	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]