StarFunc result for job id Q96QU1

User Input

>input (1955 residues)
MFRQFYLWTCLASGIILGSLFEICLGQYDDDCKLARGGPPATIVAIDEESRNGTILVDNM
LIKGTAGGPDPTIELSLKDNVDYWVLMDPVKQMLFLNSTGRVLDRDPPMNIHSIVVQVQC
INKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDID
DGPNGQIEYVIQYNPDDPTSNDTFEIPLMLTGNIVLRKRLNYEDKTRYFVIIQANDRAQN
LNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIIV
TPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELSLLEPVNRDFHQK
FDLVIKAEQDNGHPLPAFAGLHIEILDENNQSPYFTMPSYQGYILESAPVGATISDSLNL
TSPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTQTGITRYLTLLQPVDREEQQTYTFS
ITAFDGVQESEPVIVNIQVMDANDNTPTFPEISYDVYVYTDMRPGDSVIQLTAVDADEGS
NGEITYEILVGAQGDFIINKTTGLITIAPGVEMIVGRTYALTVQAADNAPPAERRNSICT
VYIEVLPPNNQSPPRFPQLMYSLEISEAMRVGAVLLNLQATDREGDSITYAIENGDPQRV
FNLSETTGILTLGKALDRESTDRYILIITASDGRPDGTSTATVNIVVTDVNDNAPVFDPY
LPRNLSVVEEEANAFVGQVKATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNRE
VRDYYELVVVATDGAVHPRHSTLTLAIKVLDIDDNSPVFTNSTYTVLVEENLPAGTTILQ
IEAKDVDLGANVSYRIRSPEVKHFFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFD
IYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGLPA
SRVRYRVDDVQFPYPASIFEVEEDSGRVITRVNLNEEPTTIFKLVVVAFDDGEPVMSSSA
TVKILVLHPGEIPRFTQEEYRPPPVSELATKGTMVGVISAAAINQSIVYSIVSGNEEDTF
GINNITGVIYVNGPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENNH
PPVFQKKFYIGGVSEDARMFTSVLRVKATDKDTGNYSVMAYRLIIPPIKEGKEGFVVETY
TGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLV
EKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAFSLEDYTKCDLTVYAIDPQTNRA
IDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLAL
AFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQAALPAAKPAVPAPAPVAAPPPPPP
PPPGAHLYEELGDSSILFLLYHFQQSRGNNSVSEDRKHQQVVMPFSSNTIEAHKSAHVDG
SLKSNKLKSARKFTFLSDEDDLSAHNPLYKENISQVSTNSDISQRTDFVDPFSPKIQAKS
KSLRGPREKIQRLWSQSVSLPRRLMRKVPNRPEIIDLQQWQGTRQKAENENTGICTNKRG
SSNPLLTTEEANLTEKEEIRQGETLMIEGTEQLKSLSSDSSFCFPRPHFSFSTLPTVSRT
VELKSEPNVISSPAECSLELSPSRPCVLHSSLSRRETPICMLPIETERNIFENFAHPPNI
SPSACPLPPPPPISPPSPPPAPAPLAPPPDISPFSLFCPPPSPPSIPLPLPPPTFFPLSV
STSGPPTPPLLPPFPTPLPPPPPSIPCPPPPSASFLSTECVCITGVKCTTNLMPAEKIKS
SMTQLSTTTVCKTDPQREPKGILRHVKNLAELEKSVANMYSQIEKNYLRTNVSELQTMCP
SEVTNMEITSEQNKGSLNNIVEGTEKQSHSQSTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5ICW6	0.255	0.272	0.000	1796	0.527	0.574	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
2	AFDB:Q96QU1	0.999	0.999	0.000	1955	1.000	1.000	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
3	AFDB:Q99PJ1	0.374	0.375	0.000	1943	0.840	0.845	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
4	AFDB:Q9VGW1	0.091	0.092	1.669E-41	1943	0.143	0.144	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
5	PDB:7sqcO0	0.092	0.139	4.316E-20	1140	0.059	0.101	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
6	AFDB:E7F5U2	0.073	0.062	6.202E-20	2497	0.077	0.060	E7F5U2.pdb.gz
7	PDB:4aq1A	0.075	0.152	7.724E-15	721	0.044	0.119	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
8	PDB:6velC	0.092	0.724	1.107E-14	209	0.028	0.263	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
9	PDB:1e07A	0.097	0.226	5.187E-14	642	0.039	0.118	1e07A.pdb.gz
10	PDB:5oj2B	0.072	0.133	7.063E-14	692	0.054	0.152	5oj2B.pdb.gz
11	PDB:7q1yA	0.067	0.088	8.583E-11	1374	0.056	0.079	7q1yA.pdb.gz
12	PDB:7q5zA	0.074	0.096	8.583E-11	1344	0.053	0.077	7q5zA.pdb.gz
13	AFDB:A0A1D8PQ86	0.044	0.045	1.004E-10	1890	0.094	0.097	A0A1D8PQ86.pdb.gz	ALS9_CANAL Agglutinin-like protein 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALS9 PE=1 SV=1
14	PDB:5a42A	0.071	0.082	2.952E-10	1597	0.073	0.090	5a42A.pdb.gz
15	PDB:7vonA	0.077	0.095	1.613E-9	1399	0.051	0.071	7vonA.pdb.gz
16	PDB:6h03A	0.053	0.068	9.774E-9	1223	0.061	0.097	6h03A.pdb.gz
17	AFDB:E9Q4Y4	0.053	0.046	1.913E-8	2514	0.061	0.048	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
18	AFDB:Q8TEP8	0.055	0.046	1.867E-6	2537	0.059	0.046	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
19	AFDB:Q9JIR0	0.062	0.064	5.870E-5	1847	0.082	0.087	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
20	AFDB:Q90X47	0.034	0.032	2.514E-3	2101	0.083	0.077	Q90X47.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1V0D7A1	0.0	1897	1726	0.495	0.560	A0A1V0D7A1_DANRE Protocadherin 15a CD3 isoform OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
2	A0A8I5Y0L1	0.0	2747	1673	0.701	0.819	A0A8I5Y0L1_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=1
3	A0A8I5ZTI9	0.0	1178	1864	0.324	0.340	A0A8I5ZTI9_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=1
4	A0A8I6A7Z6	0.0	2948	1893	0.771	0.796	A0A8I6A7Z6_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=1
5	F1LXN4	0.0	2739	1784	0.701	0.768	F1LXN4_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=4
6	Q0ZM14	0.0	2488	1899	0.633	0.651	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
7	Q5ICW5	0.0	2001	1907	0.525	0.539	Q5ICW5_DANRE Protocadherin 15b OS=Danio rerio OX=7955 GN=pcdh15b PE=2 SV=1
8	Q5ICW6	0.0	1951	1796	0.520	0.566	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
9	Q96QU1	0.0	3994	1955	1.000	1.000	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
10	Q99PJ1	0.0	3053	1943	0.792	0.797	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
11	Q9VAF5	9.36e-116	409	1706	0.195	0.224	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
12	Q6V0I7	7.09e-86	317	4981	0.155	0.061	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
13	Q2PZL6	5.61e-84	311	4981	0.154	0.060	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
14	F1QA09	6.99e-83	307	4546	0.168	0.072	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
15	X2J8E9	8.83e-83	306	3556	0.176	0.097	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
16	Q24292	1.18e-82	306	3503	0.176	0.098	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
17	X1WCY4	1.19e-82	306	4578	0.168	0.072	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
18	A0A2R8QAL3	1.20e-82	306	4601	0.168	0.072	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
19	Q9V5N8	1.09e-78	293	3579	0.142	0.077	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
20	Q8BNA6	9.65e-77	287	4555	0.161	0.069	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.6e-118	398.8	Cadherin domain
2	PF08266 Cadherin_2	0.011	26.9	Cadherin-like
3	PF16184 Cadherin_3	0.00066	31.0	Cadherin-like
4	PF08758 Cadherin_pro	91	14.6	Cadherin prodomain like
5	PF19076 CshA_repeat	81	15.4	Surface adhesin CshA repetitive domain
6	PF18432 ECD	9.7e-61	213.9	Extracellular Cadherin domain
7	PF17756 RET_CLD1	0.041	25.6	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353346	0.998	LHFPL tetraspan subfamily member 5 protein
2	9606.ENSP00000005226	0.995	Harmonin
3	9606.ENSP00000297784	0.989	Transmembrane channel-like protein 1
4	9606.ENSP00000386331	0.989	Unconventional myosin-VIIa
5	9606.ENSP00000324775	0.984	Transmembrane inner ear expressed protein
6	9606.ENSP00000381768	0.966	Cadherin-23
7	9606.ENSP00000354623	0.906	Whirlin
8	9606.ENSP00000393128	0.894	LHFPL tetraspan subfamily member 3
9	9606.ENSP00000480279	0.888	Usher syndrome type-1G protein
10	9606.ENSP00000329158	0.877	Clarin-1
11	9606.ENSP00000351732	0.872	Transmembrane channel-like protein 2
12	9606.ENSP00000305941	0.865	Usherin
13	9606.ENSP00000384582	0.852	G-protein coupled receptor 98
14	9606.ENSP00000205890	0.837	Unconventional myosin-XV
15	9606.ENSP00000310657	0.811	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
16	9606.ENSP00000258930	0.783	Calcium and integrin-binding family member 2
17	9606.ENSP00000299441	0.749	Protocadherin-16
18	9606.ENSP00000480489	0.747	PDZ domain-containing protein 7
19	9606.ENSP00000485514	0.740	Protocadherin-23
20	9606.ENSP00000377862	0.735	Protocadherin Fat 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.998	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.951	response to stimulus
GO:0051592	0.932	response to calcium ion
GO:0032501	0.660	multicellular organismal process
GO:0009987	0.527	cellular process
GO:0007600	0.433	sensory perception

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0005886	0.987	plasma membrane
GO:0005737	0.980	cytoplasm
GO:0030054	0.978	cell junction
GO:0120025	0.971	plasma membrane bounded cell projection
GO:0005576	0.968	extracellular region
GO:0005615	0.876	extracellular space
GO:0045202	0.857	synapse
GO:0043005	0.756	neuron projection
GO:0005929	0.756	cilium
GO:0097730	0.753	non-motile cilium
GO:0043229	0.612	intracellular organelle
GO:0097731	0.523	9+0 non-motile cilium
GO:0043231	0.467	intracellular membrane-bounded organelle
GO:0031982	0.459	vesicle
GO:0097733	0.458	photoreceptor cell cilium
GO:0001750	0.436	photoreceptor outer segment
GO:0043230	0.359	extracellular organelle
GO:0098858	0.331	actin-based cell projection
GO:0065010	0.304	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]