StarFunc result for job id Q96QU6

User Input

>input (501 residues)
MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDT
SYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQR
DMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATV
LCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALRE
AHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGY
RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQ
YQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL
PKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAG
KSQVAEDPRPSQSQEPSDQRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QU6	1.000	1.000	2.454E-96	501	1.000	1.000	Q96QU6.pdb.gz	1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens OX=9606 GN=ACCS PE=1 SV=1
2	AFDB:P37821	0.777	0.821	5.874E-39	473	0.277	0.294	P37821.pdb.gz	1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica OX=3750 GN=ACS-1 PE=1 SV=2
3	AFDB:Q10DK7	0.774	0.796	1.348E-38	487	0.277	0.285	Q10DK7.pdb.gz	1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ACS1 PE=2 SV=1
4	AFDB:Q9T065	0.754	0.804	3.271E-38	469	0.281	0.301	Q9T065.pdb.gz	1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1
5	AFDB:Q43309	0.758	0.799	7.937E-38	474	0.289	0.306	Q43309.pdb.gz	1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=ACS4 PE=1 SV=1
6	AFDB:Q37001	0.770	0.819	1.381E-37	470	0.263	0.281	Q37001.pdb.gz	1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana OX=3702 GN=ACS5 PE=1 SV=1
7	AFDB:Q9STR4	0.768	0.857	1.381E-37	447	0.251	0.282	Q9STR4.pdb.gz	1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana OX=3702 GN=ACS7 PE=1 SV=1
8	AFDB:Q9SAR0	0.748	0.757	6.164E-37	495	0.248	0.251	Q9SAR0.pdb.gz	1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana OX=3702 GN=ACS6 PE=1 SV=2
9	AFDB:Q7XQ85	0.777	0.805	9.601E-37	483	0.275	0.286	Q7XQ85.pdb.gz	1A12_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ACS2 PE=2 SV=1
10	AFDB:Q06402	0.768	0.776	1.766E-36	496	0.257	0.260	Q06402.pdb.gz	1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana OX=3702 GN=ACS2 PE=1 SV=1
11	PDB:1b8gB	0.755	0.884	2.595E-36	425	0.261	0.308	1b8gB.pdb.gz	Structure of 1-aminocyclopropane-1-carboxylate synthase, a key enzyme in the biosynthesis of the plant hormone ethylene.
12	PDB:7dlwB	0.744	0.884	1.445E-35	419	0.232	0.277	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.
13	PDB:3fvsA	0.673	0.795	2.104E-24	419	0.144	0.172	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
14	PDB:5wmlA	0.679	0.832	5.395E-24	404	0.178	0.220	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
15	PDB:3b46B	0.670	0.780	6.733E-24	425	0.166	0.195	3b46B.pdb.gz
16	PDB:3e2yA	0.629	0.755	1.462E-23	410	0.152	0.185	3e2yA.pdb.gz	Correction for Han et al., "Biochemical and Structural Properties of Mouse Kynurenine Aminotransferase III".
17	PDB:2o0rA	0.656	0.837	6.897E-23	385	0.174	0.226	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
18	PDB:5yhvA	0.586	0.728	3.841E-22	394	0.162	0.206	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
19	PDB:2r5cB	0.655	0.771	1.163E-21	419	0.164	0.196	2r5cB.pdb.gz	Structural insight into the mechanism of substrate specificity of aedes kynurenine aminotransferase.
20	PDB:4cvqA	0.644	0.787	4.646E-21	404	0.170	0.210	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96QU6	0.0	1040	501	1.000	1.000	1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens OX=9606 GN=ACCS PE=1 SV=1
2	Q9T065	2.93e-68	228	469	0.287	0.307	1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1
3	Q43309	1.80e-66	223	474	0.277	0.293	1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=ACS4 PE=1 SV=1
4	Q9M2Y8	7.29e-66	222	470	0.271	0.289	1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana OX=3702 GN=ACS9 PE=1 SV=1
5	Q37001	5.05e-65	219	470	0.265	0.283	1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana OX=3702 GN=ACS5 PE=1 SV=1
6	P37821	9.78e-65	219	473	0.287	0.304	1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica OX=3750 GN=ACS-1 PE=1 SV=2
7	Q9SAR0	3.16e-63	215	495	0.253	0.257	1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana OX=3702 GN=ACS6 PE=1 SV=2
8	Q7XQ85	4.83e-63	214	483	0.265	0.275	1A12_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ACS2 PE=2 SV=1
9	A9NIT9	1.28e-61	211	475	0.244	0.257	A9NIT9_GOSHI 1-aminocyclopropane-1-carboxylate synthase OS=Gossypium hirsutum OX=3635 GN=ACCS-1 PE=2 SV=1
10	Q06402	3.40e-58	202	496	0.251	0.254	1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana OX=3702 GN=ACS2 PE=1 SV=1
11	Q10DK7	7.58e-58	201	487	0.265	0.273	1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ACS1 PE=2 SV=1
12	Q9S9U6	7.91e-58	200	460	0.250	0.272	1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana OX=3702 GN=ACS11 PE=1 SV=1
13	Q9STR4	4.40e-56	195	447	0.238	0.266	1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana OX=3702 GN=ACS7 PE=1 SV=1
14	Q4WMJ9	7.91e-45	165	435	0.263	0.303	GLII_ASPFU Probable aminotransferase gliI OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gliI PE=2 SV=1
15	Q9LR30	1.32e-14	78.2	481	0.102	0.106	GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GGAT1 PE=1 SV=1
16	P52893	2.69e-14	77.8	592	0.110	0.093	ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT1 PE=1 SV=1
17	Q9S7E9	7.11e-14	76.3	481	0.102	0.106	GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GGAT2 PE=1 SV=1
18	O14209	2.09e-13	74.3	421	0.162	0.192	YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6B12.04c PE=3 SV=1
19	P52892	2.58e-12	71.2	507	0.096	0.095	ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALT2 PE=1 SV=1
20	Q9LDV4	2.25e-11	68.6	540	0.096	0.089	ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALAAT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	8.4e-54	194.7	Aminotransferase class I and II
2	PF01212 Beta_elim_lyase	1.6e+02	13.0	Beta-eliminating lyase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358417	0.711	D-3-phosphoglycerate dehydrogenase
2	9606.ENSP00000324292	0.692	Fas-binding factor 1
3	9606.ENSP00000302620	0.503	Alanine-glyoxylate aminotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0042802	0.998	identical protein binding
GO:0016829	0.952	lyase activity
GO:0008483	0.705	transaminase activity
GO:0097159	0.592	organic cyclic compound binding
GO:1901363	0.577	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0009058	0.930	biosynthetic process
GO:0044238	0.898	primary metabolic process
GO:0006807	0.715	nitrogen compound metabolic process
GO:0044249	0.712	cellular biosynthetic process
GO:1901576	0.648	organic substance biosynthetic process
GO:1901564	0.640	organonitrogen compound metabolic process
GO:0065007	0.390	biological regulation
GO:0044281	0.387	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.991	cytosol
GO:0043226	0.951	organelle
GO:0005576	0.939	extracellular region
GO:0043227	0.878	membrane-bounded organelle
GO:0043229	0.777	intracellular organelle
GO:0005615	0.758	extracellular space
GO:0043231	0.584	intracellular membrane-bounded organelle
GO:0012505	0.376	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.952	Lyases.
EC:2.6.1.-	0.705	Transaminases.

[back to server]