StarFunc result for job id Q96QU8

User Input

>input (1125 residues)
MASEEASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQIGAWRFCLYFLSSTRNDYV
MMYSLTVFENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQ
DWPMFYHDFFTNILQLIQSPVTTPLGLIMLKTTSEELACPREDLSVARKEELRKLLLDQV
QTVLGLLTGILETVWDKHSVTAATPPPSPTSGESGDLLSNLLQSPSSAKLLNQPIPILDV
ESEYICSLALECLAHLFSWIPLSASITPSLLTTIFHFARFGCDIRARKMASVNGSSQNCV
SGQERGRLGVLAMSCINELMSKNCVPMEFEEYLLRMFQQTFYLLQKITKDNNAHTVKSRL
EELDESYIEKFTDFLRLFVSVHLRRIESYSQFPVVEFLTLLFKYTFHQPTHEGYFSCLDI
WTLFLDYLTSKIKSRLGDKEAVLNRYEDALVLLLTEVLNRIQFRYNQAQLEELDDETLDD
DQQTEWQRYLRQSLEVVAKVMELLPTHAFSTLFPVLQDNLEVYLGLQQFIVTSGSGHRLN
ITAENDCRRLHCSLRDLSSLLQAVGRLAEYFIGDVFAARFNDALTVVERLVKVTLYGSQI
KLYNIETAVPSVLKPDLIDVHAQSLAALQAYSHWLAQYCSEVHRQNTQQFVTLISTTMDA
ITPLISTKVQDKLLLSACHLLVSLATTVRPVFLISIPAVQKVFNRITDASALRLVDKAQV
LVCRALSNILLLPWPNLPENEQQWPVRSINHASLISALSRDYRNLKPSAVAPQRKMPLDD
TKLIIHQTLSVLEDIVENISGESTKSRQICYQSLQESVQVSLALFPAFIHQSDVTDEMLS
FFLTLFRGLRVQMGVPFTEQIIQTFLNMFTREQLAESILHEGSTGCRVVEKFLKILQVVV
QEPGQVFKPFLPSIIALCMEQVYPIIAERPSPDVKAELFELLFRTLHHNWRYFFKSTVLA
SVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKKIFRT
AMLFQFVNVLLQVLVHKSHDLLQEEIGIAIYNMASVDFDGFFAAFLPEFLTSCDGVDANQ
KSVLGRNFKMDRDLPSFTQNVHRLVNDLRYYRLCNDSLPPGTVKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924Z6	0.999	0.999	0.000	1125	0.979	0.979	Q924Z6.pdb.gz	XPO6_MOUSE Exportin-6 OS=Mus musculus OX=10090 GN=Xpo6 PE=1 SV=2
2	AFDB:O46055	0.791	0.838	6.714E-34	1060	0.212	0.225	O46055.pdb.gz	O46055_DROME EG:165H7.3 protein OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=2
3	AFDB:Q9SMV6	0.644	0.670	2.240E-17	1075	0.137	0.143	Q9SMV6.pdb.gz	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
4	AFDB:C9J7E5	0.519	0.591	3.268E-16	957	0.128	0.150	C9J7E5.pdb.gz	C9J7E5_HUMAN Transportin 3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=1
5	AFDB:F4IZR5	0.636	0.661	3.756E-16	1076	0.139	0.145	F4IZR5.pdb.gz	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
6	AFDB:F1Q9F5	0.597	0.689	8.364E-16	953	0.143	0.169	F1Q9F5.pdb.gz	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
7	AFDB:A0A024R794	0.526	0.617	1.862E-15	923	0.122	0.148	A0A024R794.pdb.gz
8	AFDB:Q7ZW13	0.539	0.634	2.217E-15	923	0.125	0.153	Q7ZW13.pdb.gz	Q7ZW13_DANRE Transportin-3 OS=Danio rerio OX=7955 GN=zgc:55409 PE=1 SV=1
9	PDB:3wyfC	0.665	0.714	2.396E-15	1040	0.138	0.149	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
10	AFDB:P30822	0.670	0.693	4.447E-15	1084	0.140	0.146	P30822.pdb.gz	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
11	PDB:2xwuB	0.497	0.594	4.483E-15	910	0.133	0.165	2xwuB.pdb.gz
12	AFDB:P14068	0.664	0.690	5.673E-15	1078	0.136	0.142	P14068.pdb.gz	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
13	PDB:6gx9A	0.531	0.631	1.274E-14	912	0.125	0.155	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
14	PDB:5uwuC	0.614	0.684	1.868E-14	998	0.136	0.153	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
15	PDB:4c0qA	0.518	0.640	3.477E-13	871	0.116	0.150	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
16	PDB:3gjxA	0.686	0.736	5.861E-13	1041	0.131	0.141	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
17	PDB:3gb8A	0.616	0.711	8.258E-12	958	0.131	0.153	3gb8A.pdb.gz
18	PDB:2x1gF	0.535	0.643	1.392E-11	896	0.111	0.140	2x1gF.pdb.gz
19	PDB:5yu7A	0.582	0.585	1.085E-10	1118	0.133	0.134	5yu7A.pdb.gz
20	PDB:4bsmA	0.520	0.629	2.334E-10	896	0.124	0.155	4bsmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q924Z6	0.0	2279	1125	0.980	0.980	XPO6_MOUSE Exportin-6 OS=Mus musculus OX=10090 GN=Xpo6 PE=1 SV=2
2	Q96QU8	0.0	2318	1125	1.000	1.000	XPO6_HUMAN Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1
3	X2J9Y4	1.22e-59	225	1054	0.244	0.261	X2J9Y4_DROME Ellipsoid body open, isoform C OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=1
4	Q8T9F5	1.62e-59	225	1047	0.242	0.260	Q8T9F5_DROME SD03282p OS=Drosophila melanogaster OX=7227 GN=ebo PE=2 SV=1
5	Q9W5G1	2.70e-59	224	1047	0.244	0.262	Q9W5G1_DROME Ellipsoid body open, isoform A OS=Drosophila melanogaster OX=7227 GN=ebo PE=2 SV=2
6	X2JDN0	1.97e-58	221	1053	0.242	0.258	X2JDN0_DROME Ellipsoid body open, isoform B OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=1
7	O46055	1.94e-56	215	1060	0.237	0.252	O46055_DROME EG:165H7.3 protein OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=2
8	A0A1D8PRR9	6.79e-06	52.8	1079	0.038	0.040	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
9	C8VRM0	0.001	45.8	1072	0.071	0.075	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
10	P30822	0.001	45.8	1084	0.036	0.037	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
11	F4IZR5	0.002	45.1	1076	0.030	0.032	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
12	O14116	0.002	44.7	1234	0.021	0.019	YKX1_SCHPO Uncharacterized protein C328.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC328.01c PE=4 SV=2
13	E7F0E8	0.011	42.4	1071	0.032	0.034	E7F0E8_DANRE Exportin 1 (CRM1 homolog, yeast) a OS=Danio rerio OX=7955 GN=xpo1a PE=1 SV=2
14	P14068	0.018	41.6	1078	0.037	0.039	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
15	Q9PW90	0.019	41.6	1071	0.032	0.034	Q9PW90_XENLA CRM1/XPO1 protein OS=Xenopus laevis OX=8355 PE=2 SV=1
16	A1Z8S6	0.029	41.2	1218	0.036	0.033	A1Z8S6_DROME Precocious dissociation of sisters 5, isoform A OS=Drosophila melanogaster OX=7227 GN=pds5 PE=1 SV=1
17	Q7SZC2	0.033	40.8	971	0.027	0.031	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
18	Q80U96	0.049	40.4	1071	0.031	0.033	XPO1_RAT Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 PE=1 SV=1
19	Q6P5F9	0.054	40.0	1071	0.031	0.033	XPO1_MOUSE Exportin-1 OS=Mus musculus OX=10090 GN=Xpo1 PE=1 SV=1
20	O14980	0.057	40.0	1071	0.031	0.033	XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03810 IBN_N	4e-06	38.0	Importin-beta N-terminal domain
2	PF08389 Xpo1	1.3e-20	85.4	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225655	0.907	Profilin-1
2	9606.ENSP00000335193	0.894	Vam6/Vps39-like protein
3	9606.ENSP00000354742	0.887	Importin-9
4	9606.ENSP00000297440	0.866	Dynein assembly factor 5, axonemal
5	9606.ENSP00000446215	0.833	GTP-binding nuclear protein Ran
6	9606.ENSP00000252512	0.806	Exportin-7
7	9606.ENSP00000255305	0.787	Exportin-4
8	9606.ENSP00000262982	0.766	Exportin-2
9	9606.ENSP00000327821	0.748	Exportin-T
10	9606.ENSP00000301281	0.740	UBX domain-containing protein 6
11	9606.ENSP00000215832	0.735	Mitogen-activated protein kinase 1
12	9606.ENSP00000471191	0.719	Nuclear pore glycoprotein p62
13	9606.ENSP00000432768	0.709	Cytoskeleton-associated protein 5
14	9606.ENSP00000292782	0.689	DCN1-like protein 1
15	9606.ENSP00000349960	0.689	Actin, cytoplasmic 1
16	9606.ENSP00000384863	0.686	Exportin-1
17	9606.ENSP00000217109	0.680	Cleavage stimulation factor subunit 1
18	9606.ENSP00000239940	0.673	Profilin-2
19	9606.ENSP00000361418	0.670	Importin-13
20	9606.ENSP00000259569	0.669	Ran-binding protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005049	1.000	nuclear export signal receptor activity
GO:1901363	0.851	heterocyclic compound binding
GO:0097159	0.851	organic cyclic compound binding
GO:0003676	0.760	nucleic acid binding
GO:0003723	0.548	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006913	0.995	nucleocytoplasmic transport
GO:0006886	0.995	intracellular protein transport
GO:0006611	0.994	protein export from nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005654	0.997	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0016020	0.989	membrane
GO:0071944	0.987	cell periphery
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005730	0.981	nucleolus
GO:0005886	0.975	plasma membrane
GO:0012505	0.440	endomembrane system
GO:0005635	0.360	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]