StarFunc result for job id Q96QZ7

User Input

>input (1491 residues)
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGE
GPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE
EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSR
GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ
SIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTG
KVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADS
PGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQ
RGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQ
TDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ
DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKS
HQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQ
GSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRP
EAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIK
EAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFK
APQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEIL
EINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR
AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDS
GACRPKDRAPEGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSP
ERRRERSPTRRRDGSPSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRR
ERSLDKRNREDRASHREREEANLKQDAGRSSRHPPEQRRRPYKECSTDLSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QIL2	0.140	0.185	0.000	1114	0.355	0.476	E9QIL2.pdb.gz
2	AFDB:F1NMZ1	0.190	0.209	0.000	1256	0.729	0.865	F1NMZ1.pdb.gz
3	AFDB:F1Q897	0.158	0.158	0.000	1503	0.453	0.450	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
4	AFDB:H7C5T8	0.184	0.246	0.000	1014	0.670	0.985	H7C5T8.pdb.gz	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
5	AFDB:Q5F488	0.139	0.181	0.000	1128	0.365	0.482	Q5F488.pdb.gz	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
6	AFDB:Q5TCQ9	0.138	0.139	0.000	1481	0.381	0.384	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
7	AFDB:Q5VSD9	0.161	0.183	0.000	1274	0.409	0.479	Q5VSD9.pdb.gz
8	AFDB:Q6RHR9	0.311	0.314	0.000	1471	0.927	0.939	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
9	AFDB:Q86UL8	0.169	0.172	0.000	1455	0.452	0.463	Q86UL8.pdb.gz	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
10	AFDB:Q96QZ7	0.999	0.999	0.000	1491	1.000	1.000	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
11	PDB:2xkxA	0.082	0.129	2.065E-16	721	0.061	0.126	2xkxA.pdb.gz
12	PDB:5n7dA	0.071	0.247	2.859E-16	423	0.069	0.243	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
13	PDB:7p73A	0.058	0.200	4.121E-7	420	0.023	0.081	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7pc3A	0.056	0.202	1.687E-6	405	0.019	0.069	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6t36A	0.059	0.863	4.726E-6	93	0.016	0.258	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7qqnC	0.053	0.186	9.059E-6	414	0.017	0.063	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p70A	0.055	0.200	1.125E-5	407	0.015	0.054	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7qqmA	0.054	0.193	2.157E-5	413	0.019	0.068	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7pc5A	0.055	0.197	3.915E-5	405	0.018	0.067	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.059	0.198	7.922E-5	415	0.021	0.077	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WT53	0.0	2351	1155	0.774	0.999	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
2	A0A087WXD2	0.0	1917	980	0.625	0.951	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	A0A8I3NPD4	0.0	2559	1398	0.858	0.916	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
4	F1Q897	0.0	910	1503	0.364	0.361	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
5	H7C4U7	0.0	2258	1131	0.736	0.971	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
6	H7C535	0.0	2251	1136	0.736	0.966	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	H7C5T8	0.0	2045	1014	0.670	0.985	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
8	O88382	0.0	975	1277	0.379	0.442	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
9	Q5F488	0.0	920	1128	0.372	0.491	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
10	Q5TCQ9	0.0	911	1481	0.355	0.358	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	Q6RHR9	0.0	2638	1471	0.931	0.944	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
12	Q86UL8	0.0	969	1455	0.376	0.385	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
13	Q96QZ7	0.0	3065	1491	1.000	1.000	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
14	Q9EQJ9	0.0	909	1476	0.363	0.367	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
15	Q9JK71	0.0	919	1470	0.366	0.371	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
16	Q9WVQ1	0.0	970	1275	0.377	0.441	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
17	C6KRJ8	3.34e-112	376	802	0.205	0.382	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
18	C1P634	1.62e-111	375	855	0.205	0.358	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
19	Q9W2L2	3.00e-95	337	1202	0.135	0.168	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
20	D3YT29	4.96e-74	267	829	0.140	0.251	D3YT29_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	0.0065	27.3	Family of unknown function (DUF6288)
2	PF00625 Guanylate_kin	6.8e-07	40.7	Guanylate kinase
3	PF16663 MAGI_u1	1.6e-29	113.0	Unstructured region on MAGI
4	PF16666 MAGI_u5	1.8e-33	126.7	Unstructured region on MAGI
5	PF00595 PDZ	1e-64	226.2	PDZ domain
6	PF13180 PDZ_2	8e-26	101.6	PDZ domain
7	PF17820 PDZ_6	1e-41	151.9	PDZ domain
8	PF03543 Peptidase_C58	90	14.2	Yersinia/Haemophilus virulence surface antigen
9	PF02163 Peptidase_M50	8.4e-14	63.2	Peptidase family M50
10	PF17875 RPA43_OB	2e+02	13.8	RPA43 OB domain in RNA Pol I
11	PF04360 Serglycin	1.5e+02	13.8	Serglycin
12	PF03153 TFIIA	29	16.1	Transcription factor IIA, alpha/beta subunit
13	PF14685 Tricorn_PDZ	0.00064	31.0	Tricorn protease PDZ domain
14	PF00397 WW	7.3e-15	66.0	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008962220.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008949747.1	0.963	Catenin beta 1
2	9597.XP_008974383.1	0.931	Rap guanine nucleotide exchange factor 2
3	9597.XP_003823958.1	0.930	Immunoglobulin superfamily member 5
4	9597.XP_008962912.1	0.924	Actinin alpha 4
5	9597.XP_008952691.1	0.923	Synaptopodin
6	9597.XP_003810548.1	0.909	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
7	9597.XP_003829370.1	0.840	Rap guanine nucleotide exchange factor 6
8	9597.XP_003824135.1	0.837	Alpha-actinin-1 isoform X1
9	9597.XP_003846256.1	0.822	Membrane associated guanylate kinase, WW and PDZ domain containing 3
10	9597.XP_008967608.1	0.812	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
11	9597.XP_003828112.1	0.811	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates
12	9597.XP_008962834.1	0.793	Par-6 family cell polarity regulator alpha
13	9597.XP_003807363.1	0.745	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
14	9597.XP_003831969.1	0.740	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
15	9597.XP_003815309.1	0.710	Par-6 family cell polarity regulator beta
16	9597.XP_008967022.1	0.710	Par-6 family cell polarity regulator gamma
17	9597.XP_003825872.1	0.709	Dendrin
18	9597.XP_008965851.1	0.702	Par-3 family cell polarity regulator
19	9597.XP_003804292.1	0.683	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 754 ESTs, 35 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
20	9597.XP_003811648.1	0.650	26S proteasome non-ATPase regulatory subunit 6 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.988	cytoskeletal protein binding
GO:0051393	0.978	alpha-actinin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.975	response to stimulus
GO:0051716	0.955	cellular response to stimulus
GO:0048518	0.946	positive regulation of biological process
GO:0007154	0.944	cell communication
GO:0023052	0.942	signaling
GO:0007165	0.922	signal transduction
GO:0048522	0.918	positive regulation of cellular process
GO:0030155	0.883	regulation of cell adhesion
GO:0007155	0.659	cell adhesion
GO:0032501	0.573	multicellular organismal process
GO:0071840	0.410	cellular component organization or biogenesis
GO:0016043	0.400	cellular component organization
GO:0048856	0.397	anatomical structure development
GO:0048519	0.355	negative regulation of biological process
GO:0007166	0.334	cell surface receptor signaling pathway
GO:0045785	0.311	positive regulation of cell adhesion
GO:0019222	0.309	regulation of metabolic process
GO:0048523	0.305	negative regulation of cellular process
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005634	0.999	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0016020	0.994	membrane
GO:0031981	0.994	nuclear lumen
GO:0005737	0.985	cytoplasm
GO:0043228	0.978	non-membrane-bounded organelle
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0005654	0.969	nucleoplasm
GO:0070161	0.956	anchoring junction
GO:0005911	0.950	cell-cell junction
GO:0071944	0.882	cell periphery
GO:0005886	0.840	plasma membrane
GO:0005829	0.725	cytosol
GO:0005730	0.493	nucleolus
GO:0042995	0.335	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]