StarFunc result for job id Q96R06

User Input

>input (1193 residues)
MWRVKKLSLSLSPSPQTGKPSMRTPLRELTLQPGALTNSGKRSPACSSLTPSLCKLGLQE
GSNNSSPVDFVNNKRTDLSSEHFSHSSKWLETCQHESDEQPLDPIPQISSTPKTSEEAVD
PLGNYMVKTIVLVPSPLGQQQDMIFEARLDTMAETNSISLNGPLRTDDLVREEVAPCMGD
RFSEVAAVSEKPIFQESPSHLLEESPPNPCSEQLHCSKESLSSRTEAVREDLVPSESNAF
LPSSVLWLSPSTALAADFRVNHVDPEEEIVEHGAMEEREMRFPTHPKESETEDQALVSSV
EDILSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGVNTSVMLENLR
QSLSLPSMLRDAAIGTTPFSTCSVGTWFTPSAPQEKSTNTSQTGLVGTKHSTSETEQLLC
GRPPDLTALSRHDLEDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGI
TNKLQHLKESHEMGQALQQARNVMQSWVLISKELISLLHLSLLHLEEDKTTVSQESRRAE
TLVCCCFDLLKKLRAKLQSLKAEREEARHREEMALRGKDAAEIVLEAFCAHASQRISQLE
QDLASMREFRGLLKDAQTQLVGLHAKQEELVQQTVSLTSTLQQDWRSMQLDYTTWTALLS
RSRQLTEKLTVKSQQALQERDVAIEEKQEVSRVLEQVSAQLEECKGQTEQLELENSRLAT
DLRAQLQILANMDSQLKELQSQHTHCAQDLAMKDELLCQLTQSNEEQAAQWQKEEMALKH
MQAELQQQQAVLAKEVRDLKETLEFADQENQVAHLELGQVECQLKTTLEVLRERSLQCEN
LKDTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQET
LLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQP
AETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQ
KAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLR
RAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKF
QSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96R06	0.999	0.999	0.000	1193	1.000	1.000	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
2	AFDB:Q7TME2	0.267	0.272	5.794E-101	1165	0.640	0.656	Q7TME2.pdb.gz	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
3	AFDB:Q62036	0.134	0.146	1.003E-13	1060	0.136	0.153	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
4	AFDB:U3JAG9	0.096	0.102	3.428E-12	1113	0.153	0.164	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
5	AFDB:I3L2J8	0.142	0.158	1.087E-11	1047	0.141	0.160	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
6	AFDB:Q9UPN4	0.086	0.094	1.342E-10	1083	0.141	0.155	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
7	AFDB:Q8BI79	0.092	0.092	3.031E-10	1192	0.141	0.141	Q8BI79.pdb.gz	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
8	AFDB:Q9PTD7	0.119	0.106	1.546E-9	1360	0.156	0.137	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
9	AFDB:Q4G0X9	0.084	0.086	2.488E-9	1142	0.167	0.174	Q4G0X9.pdb.gz	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
10	AFDB:B9EK46	0.094	0.094	3.739E-9	1203	0.166	0.165	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
11	PDB:6id0L	0.065	0.146	2.504E-1	475	0.037	0.093	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:6qdvO	0.072	0.173	5.657E-1	441	0.045	0.122	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
13	PDB:5yzgL	0.070	0.164	1.795	419	0.037	0.105	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:6ff7K	0.052	0.260	2.355	213	0.014	0.080	6ff7K.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:6iczL	0.065	0.153	2.355	454	0.039	0.101	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:2q0oD	0.035	0.335	2.697	87	0.007	0.092	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
17	PDB:5z56L	0.071	0.200	2.697	342	0.030	0.105	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:5svaU	0.043	0.228	2.887	156	0.012	0.090	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
19	PDB:7c4jB	0.068	0.185	3.539	395	0.020	0.061	7c4jB.pdb.gz
20	PDB:7enag	0.056	0.265	4.339	166	0.015	0.108	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TME2	0.0	1438	1165	0.659	0.675	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
2	Q96R06	0.0	2404	1193	1.000	1.000	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
3	Q8VDD5	0.006	43.5	1960	0.070	0.042	MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4
4	Q5AMN3	0.040	40.8	1165	0.029	0.030	ATG11_CANAL Autophagy-related protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG11 PE=2 SV=1
5	Q62812	0.50	37.4	1961	0.067	0.041	MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 PE=1 SV=3
6	Q4G051	0.57	37.0	638	0.059	0.110	Q4G051_RAT Numa1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Numa1 PE=2 SV=1
7	P35579	2.8	34.7	1960	0.066	0.040	MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4
8	F4I9A1	2.9	34.7	1807	0.069	0.045	F4I9A1_ARATH TGN-related, localized SYP41 interacting protein OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=1 SV=1
9	F4I9A2	3.0	34.7	1767	0.069	0.046	TNO1_ARATH Trans-Golgi network-localized SYP41-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=1 SV=2
10	F7DP49	4.5	33.9	596	0.031	0.062	DEUP1_XENTR Deuterosome assembly protein 1 OS=Xenopus tropicalis OX=8364 GN=deup1 PE=3 SV=2
11	Q5T9S5	6.6	33.5	1454	0.046	0.038	CCD18_HUMAN Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18 PE=1 SV=1
12	Q96Q89	7.8	33.1	1820	0.042	0.027	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03450 CO_deh_flav_C	5.1e+02	12.2	CO dehydrogenase flavoprotein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323300

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249776	0.973	Small kinetochore-associated protein
2	9606.ENSP00000287598	0.970	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
3	9606.ENSP00000411532	0.963	DNA topoisomerase 2-alpha
4	9606.ENSP00000288207	0.958	G2/mitotic-specific cyclin-B2
5	9606.ENSP00000302530	0.958	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000260731	0.957	Kinesin-like protein KIF11
7	9606.ENSP00000361298	0.957	Kinesin-like protein KIF2C
8	9606.ENSP00000313950	0.954	Aurora kinase B
9	9606.ENSP00000361540	0.954	Cell division cycle protein 20 homolog
10	9606.ENSP00000360540	0.953	Centrosomal protein of 55 kDa
11	9606.ENSP00000247191	0.952	Disks large-associated protein 5
12	9606.ENSP00000257934	0.950	Separin
13	9606.ENSP00000324020	0.950	Kinesin-like protein KIF15
14	9606.ENSP00000378356	0.949	Kinesin-like protein KIF20A
15	9606.ENSP00000261597	0.948	Kinetochore protein NDC80 homolog
16	9606.ENSP00000362146	0.945	Borealin
17	9606.ENSP00000348838	0.944	Ubiquitin-conjugating enzyme E2 C
18	9606.ENSP00000301633	0.942	Baculoviral IAP repeat containing 5
19	9606.ENSP00000356379	0.941	Abnormal spindle-like microcephaly-associated protein
20	9606.ENSP00000265148	0.938	Centromere-associated protein E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0051726	0.980	regulation of cell cycle
GO:0033043	0.980	regulation of organelle organization
GO:0022402	0.969	cell cycle process
GO:0016043	0.963	cellular component organization
GO:0000278	0.958	mitotic cell cycle
GO:1903047	0.938	mitotic cell cycle process
GO:0006996	0.927	organelle organization
GO:0010564	0.925	regulation of cell cycle process
GO:0048518	0.899	positive regulation of biological process
GO:0000226	0.899	microtubule cytoskeleton organization
GO:0048522	0.893	positive regulation of cellular process
GO:0007059	0.886	chromosome segregation
GO:0051276	0.868	chromosome organization
GO:0051641	0.813	cellular localization
GO:0098813	0.808	nuclear chromosome segregation
GO:0140014	0.803	mitotic nuclear division
GO:0033036	0.802	macromolecule localization
GO:0070727	0.663	cellular macromolecule localization
GO:0000070	0.570	mitotic sister chromatid segregation
GO:0045787	0.476	positive regulation of cell cycle
GO:0008104	0.455	protein localization
GO:0007051	0.449	spindle organization
GO:0090068	0.439	positive regulation of cell cycle process
GO:0033365	0.418	protein localization to organelle
GO:0051130	0.360	positive regulation of cellular component organization
GO:0010638	0.341	positive regulation of organelle organization
GO:0032886	0.300	regulation of microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0072686	0.999	mitotic spindle
GO:0005813	0.996	centrosome
GO:0099080	0.993	supramolecular complex
GO:0098687	0.987	chromosomal region
GO:0000775	0.976	chromosome, centromeric region
GO:0000779	0.959	condensed chromosome, centromeric region
GO:0000776	0.952	kinetochore
GO:0000922	0.886	spindle pole
GO:0099512	0.877	supramolecular fiber
GO:0016604	0.875	nuclear body
GO:0099513	0.868	polymeric cytoskeletal fiber
GO:0005874	0.858	microtubule
GO:0097431	0.757	mitotic spindle pole
GO:0035371	0.729	microtubule plus-end
GO:0034451	0.709	centriolar satellite
GO:0032991	0.431	protein-containing complex
GO:0016020	0.333	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]