StarFunc result for job id Q96RD9

User Input

>input (977 residues)
MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHR
YLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVV
LRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNT
VKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWS
LSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFE
GTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNG
LGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAA
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSA
EALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYY
CTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWF
YHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPI
LTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASFNLSLTTE
HSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSP
LILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL
TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYH
NVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVA
STPVSGSLFLASSAPHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RD9	1.000	1.000	0.000	977	1.000	1.000	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
2	AFDB:Q96P31	0.248	0.325	1.212E-61	734	0.360	0.480	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
3	AFDB:Q68SN8	0.303	0.466	5.483E-41	596	0.207	0.339	Q68SN8.pdb.gz	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
4	AFDB:Q96LA5	0.176	0.334	6.002E-37	508	0.198	0.380	Q96LA5.pdb.gz	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
5	AFDB:Q96PJ5	0.288	0.522	2.903E-35	515	0.177	0.336	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
6	AFDB:Q08481	0.256	0.338	7.657E-35	727	0.146	0.197	Q08481.pdb.gz	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
7	AFDB:P43146	0.147	0.106	3.799E-27	1447	0.158	0.106	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
8	AFDB:Q96LA6	0.216	0.457	1.364E-26	429	0.168	0.382	Q96LA6.pdb.gz	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
9	AFDB:A0A087WV75	0.189	0.205	3.597E-26	884	0.155	0.171	A0A087WV75.pdb.gz	A0A087WV75_HUMAN Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1 PE=1 SV=1
10	AFDB:Q9W213	0.217	0.169	9.487E-26	1395	0.162	0.113	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
11	PDB:5oj2B	0.164	0.218	2.382E-22	692	0.137	0.194	5oj2B.pdb.gz
12	PDB:1e07A	0.341	0.456	2.938E-21	642	0.123	0.187	1e07A.pdb.gz
13	PDB:5a42A	0.103	0.071	3.749E-19	1597	0.121	0.074	5a42A.pdb.gz
14	PDB:7q1yA	0.102	0.080	6.964E-15	1374	0.097	0.069	7q1yA.pdb.gz
15	PDB:7q5zA	0.105	0.081	8.681E-15	1344	0.097	0.071	7q5zA.pdb.gz
16	PDB:4ziqA	0.103	0.075	1.410E-14	1450	0.111	0.074	4ziqA.pdb.gz
17	PDB:6h03A	0.116	0.097	7.202E-14	1223	0.082	0.065	6h03A.pdb.gz
18	PDB:7sqcO0	0.149	0.135	1.222E-13	1140	0.101	0.087	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:4lnvA	0.104	0.086	2.474E-13	1276	0.076	0.058	4lnvA.pdb.gz
20	PDB:7vonA	0.102	0.082	5.470E-13	1399	0.100	0.070	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RD9	0.0	2007	977	1.000	1.000	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
2	Q96P31	7.50e-141	440	734	0.255	0.339	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
3	Q68SN8	4.00e-112	360	596	0.210	0.344	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
4	Q96PJ5	1.10e-99	324	515	0.181	0.344	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
5	Q96LA5	1.48e-90	300	508	0.176	0.339	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
6	Q96LA6	1.83e-68	237	429	0.175	0.399	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
7	Q5DRQ8	4.97e-44	167	427	0.111	0.253	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
8	Q6BAA4	1.45e-42	163	426	0.111	0.254	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
9	P12314	2.46e-41	158	374	0.110	0.286	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
10	P26151	1.83e-37	147	404	0.104	0.252	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
11	Q6DN72	1.18e-31	131	434	0.130	0.293	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
12	Q7L513	6.26e-30	124	359	0.090	0.245	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
13	A0A0B4J2J0	1.88e-27	117	353	0.092	0.255	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
14	Q920A9	1.21e-26	114	352	0.080	0.222	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
15	O75015	5.19e-26	109	233	0.074	0.309	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
16	D3YXG0	7.12e-26	118	5634	0.217	0.038	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
17	P31994	1.06e-25	110	310	0.076	0.239	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
18	P31995	1.26e-25	111	323	0.076	0.229	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
19	Q08481	4.00e-25	114	727	0.158	0.212	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
20	A3RFZ7	1.07e-24	106	254	0.086	0.331	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16640 Big_3_5	24	16.5	Bacterial Ig-like domain (group 3)
2	PF05790 C2-set	2.5	19.7	Immunoglobulin C2-set domain
3	PF11589 DUF3244	27	16.3	Domain of unknown function (DUF3244)
4	PF01105 EMP24_GP25L	2.2	19.7	emp24/gp25L/p24 family/GOLD
5	PF07679 I-set	4.2e-22	89.4	Immunoglobulin I-set domain
6	PF00047 ig	2.8e-32	122.1	Immunoglobulin domain
7	PF13895 Ig_2	3.2e-86	295.0	Immunoglobulin domain
8	PF13927 Ig_3	7.2e-73	252.5	Immunoglobulin domain
9	PF16681 Ig_5	6.1e-12	57.1	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF17736 Ig_C17orf99	9.6e-38	139.5	C17orf99 Ig domain
11	PF03456 uDENN	49	15.8	uDENN domain
12	PF07686 V-set	1.5e-08	46.1	Immunoglobulin V-set domain
13	PF08204 V-set_CD47	1.6e-07	42.8	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348888	0.773	Polymeric immunoglobulin receptor
2	9606.ENSP00000234739	0.721	B-cell CLL/lymphoma 9 protein
3	9606.ENSP00000356024	0.651	Complement receptor type 2
4	9606.ENSP00000364907	0.577	Tyrosine-protein kinase SYK
5	9606.ENSP00000379980	0.538	B-cell differentiation antigen CD72
6	9606.ENSP00000266557	0.519	CD27 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.418	identical protein binding
GO:0038023	0.389	signaling receptor activity
GO:0005102	0.325	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0019222	0.925	regulation of metabolic process
GO:0050896	0.888	response to stimulus
GO:0048518	0.864	positive regulation of biological process
GO:0048519	0.789	negative regulation of biological process
GO:0002376	0.779	immune system process
GO:0060255	0.776	regulation of macromolecule metabolic process
GO:0048522	0.764	positive regulation of cellular process
GO:0032501	0.732	multicellular organismal process
GO:0048583	0.708	regulation of response to stimulus
GO:0002682	0.653	regulation of immune system process
GO:0009893	0.519	positive regulation of metabolic process
GO:0010468	0.511	regulation of gene expression
GO:0050776	0.497	regulation of immune response
GO:0051239	0.496	regulation of multicellular organismal process
GO:0051171	0.489	regulation of nitrogen compound metabolic process
GO:0010604	0.477	positive regulation of macromolecule metabolic process
GO:0080090	0.462	regulation of primary metabolic process
GO:0031323	0.457	regulation of cellular metabolic process
GO:0002684	0.444	positive regulation of immune system process
GO:0051716	0.400	cellular response to stimulus
GO:0048584	0.393	positive regulation of response to stimulus
GO:0007154	0.391	cell communication
GO:0023052	0.389	signaling
GO:0007165	0.363	signal transduction
GO:0048523	0.330	negative regulation of cellular process
GO:0051249	0.301	regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0032991	0.984	protein-containing complex
GO:0009986	0.982	cell surface
GO:0071944	0.961	cell periphery
GO:0043235	0.947	receptor complex
GO:0016020	0.936	membrane
GO:0005886	0.853	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]