StarFunc result for job id Q96RE9

User Input

>input (604 residues)
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKL
EQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGS
LCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDIS
IQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP
FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG
ACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGK
AFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE
KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL
IIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQ
RIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT
VVKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MS50	0.557	0.557	2.748E-94	604	0.997	0.997	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
2	AFDB:P51523	0.324	0.267	6.094E-58	738	0.523	0.428	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
3	AFDB:Q5MCW4	0.507	0.450	6.529E-56	686	0.480	0.423	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
4	AFDB:Q06732	0.517	0.407	1.423E-55	778	0.505	0.392	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
5	AFDB:P51814	0.498	0.377	2.348E-55	821	0.492	0.362	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
6	AFDB:Q9P2J8	0.492	0.353	5.600E-54	865	0.457	0.319	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	AFDB:Q6NX49	0.510	0.435	1.612E-53	715	0.447	0.378	Q6NX49.pdb.gz	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
8	AFDB:Q14587	0.434	0.291	1.802E-53	947	0.460	0.294	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
9	AFDB:Q16587	0.519	0.490	2.812E-53	644	0.419	0.393	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
10	AFDB:Q9UJW8	0.507	0.446	3.513E-53	692	0.460	0.402	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
11	PDB:3w5kB	0.082	0.249	2.057E-4	110	0.071	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.080	0.094	6.941E-1	457	0.055	0.072	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7ad8D	0.047	0.081	1.211	280	0.053	0.114	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
14	PDB:6eu0Z	0.066	0.087	1.280	339	0.055	0.097	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
15	PDB:6o9lQ	0.050	0.062	1.513	430	0.061	0.086	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:5gm6a	0.031	0.109	1.691	123	0.040	0.195	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6gejS	0.046	0.108	1.691	208	0.055	0.159	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:5iy7M	0.057	0.083	1.788	310	0.043	0.084	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
19	PDB:7dvqM	0.043	0.099	1.788	191	0.053	0.168	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7o4i1	0.075	0.080	1.788	522	0.070	0.080	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS50	0.0	1241	604	0.997	0.997	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
2	O94892	0.0	543	652	0.503	0.466	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
3	P17014	0.0	534	697	0.517	0.448	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
4	P51523	0.0	592	738	0.530	0.434	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
5	P51814	0.0	555	821	0.503	0.370	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
6	P52742	0.0	533	658	0.497	0.456	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	Q14587	0.0	540	947	0.498	0.318	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
8	Q5MCW4	0.0	557	686	0.513	0.452	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
9	Q6ECI4	0.0	553	717	0.492	0.414	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
10	Q8N184	0.0	528	647	0.505	0.471	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
11	Q96RE9	0.0	1246	604	1.000	1.000	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
12	Q9BX82	0.0	535	626	0.477	0.460	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
13	Q9P2J8	0.0	545	865	0.488	0.341	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
14	Q9Y473	0.0	542	711	0.497	0.422	ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens OX=9606 GN=ZNF175 PE=1 SV=1
15	Q8TAQ5	3.22e-179	525	688	0.488	0.429	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
16	P17031	4.12e-179	519	533	0.464	0.525	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
17	Q6PF04	1.26e-175	513	617	0.490	0.480	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
18	P15622	1.57e-175	511	560	0.462	0.498	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
19	Q9NYW8	9.42e-173	509	714	0.508	0.430	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
20	A6NNF4	2.19e-172	505	616	0.467	0.458	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	3.6e-06	38.4	TFIIH C1-like domain
2	PF05864 Chordopox_RPO7	1.2e+02	14.3	Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7)
3	PF03604 DNA_RNApol_7kD	4	18.5	DNA directed RNA polymerase, 7 kDa subunit
4	PF19196 DUF5871	4.3e+02	12.1	Family of unknown function (DUF5871)
5	PF01352 KRAB	3e-23	92.4	KRAB box
6	PF01429 MBD	2.6e+02	12.7	Methyl-CpG binding domain
7	PF01286 XPA_N	1.9e+02	13.5	XPA protein N-terminal
8	PF00096 zf-C2H2	2.9e-70	240.1	Zinc finger, C2H2 type
9	PF13894 zf-C2H2_4	5.3e-34	125.0	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	7.4e-09	46.6	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	0.0065	28.0	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	2.8e-86	291.7	Zinc-finger double domain
13	PF18439 zf_UBZ	2.4	19.2	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	1	21.5	zinc-ribbon family
15	PF09723 Zn-ribbon_8	3e-06	38.6	Zinc ribbon domain
16	PF17283 Zn_ribbon_SprT	0.13	23.6	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428220	0.764	Immunity-related GTPase family M protein
2	9606.ENSP00000252809	0.664	Growth differentiation factor 15
3	9606.ENSP00000442308	0.655	NF-kappa-B-repressing factor
4	9606.ENSP00000303942	0.592	Platelet glycoprotein IX
5	9606.ENSP00000435373	0.592	Cyclin-J
6	9606.ENSP00000385689	0.587	GRAM domain-containing protein 4
7	9606.ENSP00000354721	0.567	Sulfate anion transporter 1
8	9606.ENSP00000405252	0.547	A-kinase anchor protein 7 isoform gamma
9	9606.ENSP00000230048	0.521	Acyl-coenzyme A thioesterase 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.827	heterocyclic compound binding
GO:0097159	0.827	organic cyclic compound binding
GO:0003677	0.805	DNA binding
GO:0043565	0.779	sequence-specific DNA binding
GO:0003690	0.743	double-stranded DNA binding
GO:0003700	0.502	DNA-binding transcription factor activity
GO:1990837	0.410	sequence-specific double-stranded DNA binding
GO:0000981	0.389	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0048518	0.969	positive regulation of biological process
GO:0048522	0.924	positive regulation of cellular process
GO:0051173	0.835	positive regulation of nitrogen compound metabolic process
GO:0051254	0.825	positive regulation of RNA metabolic process
GO:0045893	0.812	positive regulation of DNA-templated transcription
GO:0006357	0.662	regulation of transcription by RNA polymerase II
GO:0048523	0.515	negative regulation of cellular process
GO:0009987	0.400	cellular process
GO:0010605	0.370	negative regulation of macromolecule metabolic process
GO:0031324	0.355	negative regulation of cellular metabolic process
GO:0051172	0.353	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0043232	0.902	intracellular non-membrane-bounded organelle
GO:0005737	0.645	cytoplasm
GO:0005730	0.583	nucleolus
GO:0016604	0.477	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]