StarFunc result for job id Q96RG2

User Input

>input (1323 residues)
MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSC
LSPQPAPGVDNVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDV
KPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQ
LAGGSLLMHCPCYGSEWGLWWRSQDLAPSPSGMAGLSFGTPTLDEPWLGVENDREELQTC
LIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLGGRDLCGGCTGSSSACYALAT
DLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETPSSLAVGSDPD
VGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYH
RDGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAE
LTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKE
KNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLV
MEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF
TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEE
NPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRL
LTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CEE6	0.346	0.333	0.000	1383	0.726	0.694	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
2	AFDB:Q96RG2	1.000	1.000	0.000	1323	1.000	1.000	Q96RG2.pdb.gz	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
3	PDB:7myjC	0.185	0.511	1.555E-19	465	0.063	0.178	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
4	PDB:5ufuA	0.185	0.640	2.038E-19	369	0.061	0.220	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
5	PDB:6b1uA	0.184	0.537	2.038E-19	442	0.060	0.179	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
6	PDB:4zhxA	0.184	0.578	2.151E-19	409	0.060	0.193	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
7	PDB:4rerA	0.184	0.518	2.976E-19	459	0.059	0.170	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
8	PDB:7ooxA	0.192	0.844	8.314E-19	285	0.068	0.316	7ooxA.pdb.gz	Crystal Structure-Guided Design of Bisubstrate Inhibitors and Photoluminescent Probes for Protein Kinases of the PIM Family.
9	PDB:5u6yA	0.178	0.485	2.200E-18	459	0.061	0.176	5u6yA.pdb.gz
10	PDB:4rewA	0.179	0.559	4.444E-18	411	0.058	0.187	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
11	PDB:4eomC	0.175	0.788	1.055E-17	276	0.057	0.272	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:5x3fB	0.172	0.606	2.019E-17	349	0.055	0.209	5x3fB.pdb.gz
13	AFDB:P18161	0.176	0.200	1.775E-14	1155	0.122	0.139	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
14	AFDB:P18160	0.196	0.118	6.099E-12	2410	0.163	0.089	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
15	AFDB:Q9TW45	0.177	0.196	1.061E-8	1192	0.098	0.108	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
16	AFDB:E1JIM6	0.114	0.142	2.388E-8	1015	0.093	0.121	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
17	AFDB:Q9VBH3	0.111	0.150	5.672E-8	920	0.073	0.104	Q9VBH3.pdb.gz	Q9VBH3_DROME Dysfusion, isoform D OS=Drosophila melanogaster OX=7227 GN=dysf PE=4 SV=4
18	AFDB:E1C4K6	0.078	0.106	7.845E-8	882	0.097	0.145	E1C4K6.pdb.gz	E1C4K6_CHICK Aryl hydrocarbon receptor 2 OS=Gallus gallus OX=9031 PE=2 SV=3
19	AFDB:Q8JIG3	0.073	0.110	1.276E-7	845	0.079	0.124	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
20	AFDB:Q9W705	0.073	0.065	3.764E-7	1516	0.090	0.078	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CEE6	0.0	1173	1383	0.454	0.435	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
2	Q96RG2	0.0	2699	1323	1.000	1.000	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
3	P31374	6.22e-50	196	1356	0.075	0.073	PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSK1 PE=1 SV=2
4	Q9UTH3	1.11e-48	189	775	0.076	0.130	PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk6 PE=1 SV=2
5	Q08217	9.99e-48	189	1101	0.073	0.087	PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSK2 PE=1 SV=1
6	Q9TW45	1.83e-43	175	1192	0.072	0.080	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
7	H2KYA5	6.53e-42	171	1793	0.073	0.054	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
8	O60285	9.66e-42	166	661	0.065	0.130	NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens OX=9606 GN=NUAK1 PE=1 SV=1
9	H2KYA7	9.69e-42	170	1483	0.073	0.065	H2KYA7_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
10	D1MN54	1.11e-41	170	1554	0.073	0.062	D1MN54_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
11	A0A8I6A623	1.16e-41	166	688	0.076	0.147	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
12	H2KYA8	1.25e-41	170	1480	0.073	0.065	H2KYA8_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
13	D1MN51	1.29e-41	170	1578	0.073	0.061	D1MN51_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
14	H2KYA9	1.38e-41	170	1544	0.073	0.062	H2KYA9_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
15	H2KYA6	1.40e-41	169	1490	0.073	0.064	H2KYA6_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
16	O08679	1.92e-41	166	722	0.073	0.134	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
17	A0A0G2JTD8	1.97e-41	166	744	0.076	0.136	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
18	E1JGM9	2.02e-41	167	827	0.072	0.115	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
19	E7ETY4	2.12e-41	166	763	0.074	0.128	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
20	Q6NPA6	2.25e-41	167	833	0.072	0.114	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	28	15.3	ABC1 atypical kinase-like domain
2	PF19250 DUF5898	3.5e+02	12.5	Family of unknown function (DUF5898)
3	PF14531 Kinase-like	19	16.0	Kinase-like
4	PF00989 PAS	1e-07	43.3	PAS fold
5	PF08446 PAS_2	5e+02	12.8	PAS fold
6	PF08448 PAS_4	4.4e+02	12.6	PAS fold
7	PF13188 PAS_8	2.7	19.4	PAS domain
8	PF13426 PAS_9	9.2e-14	63.0	PAS domain
9	PF00069 Pkinase	4.1e-53	192.0	Protein kinase domain
10	PF17667 Pkinase_fungal	61	13.8	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	2.3e-20	84.6	Protein tyrosine and serine/threonine kinase
12	PF18494 Pullulanase_Ins	6.5e+02	12.2	Pullulanase Ins domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234038	0.923	Protein phosphatase 1 regulatory subunit 7
2	9606.ENSP00000356853	0.917	Uridine-cytidine kinase 2
3	9606.ENSP00000338703	0.870	UTP--glucose-1-phosphate uridylyltransferase
4	9606.ENSP00000317904	0.805	Glycogen [starch] synthase, muscle
5	9606.ENSP00000275730	0.767	Solute carrier family 12 member 9
6	9606.ENSP00000311502	0.761	Protein HEG homolog 1
7	9606.ENSP00000265840	0.746	ELMO domain-containing protein 1
8	9606.ENSP00000335557	0.721	SLX4 interacting protein
9	9606.ENSP00000377047	0.705	Receptor-type tyrosine-protein phosphatase zeta
10	9606.ENSP00000341141	0.695	Sialoadhesin
11	9606.ENSP00000394770	0.674	Cardiomyopathy-associated protein 5
12	9606.ENSP00000313504	0.656	Phosphorylase b kinase regulatory subunit beta
13	9606.ENSP00000464788	0.620	Zinc finger protein 285
14	9606.ENSP00000359674	0.600	Uncharacterized protein C10orf62
15	9606.ENSP00000400010	0.598	Receptor-type tyrosine-protein phosphatase eta
16	9606.ENSP00000444537	0.586	Protein ARMCX6
17	9606.ENSP00000289547	0.579	Niemann-Pick C1-like protein 1
18	9606.ENSP00000335040	0.561	Niban-like protein 2
19	9606.ENSP00000357511	0.559	Uncharacterized protein C1orf189
20	9606.ENSP00000229328	0.553	5'-AMP-activated protein kinase subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035091	1.000	phosphatidylinositol binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0044238	0.995	primary metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0006793	0.985	phosphorus metabolic process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0006796	0.975	phosphate-containing compound metabolic process
GO:0036211	0.975	protein modification process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0010468	0.959	regulation of gene expression
GO:0048518	0.950	positive regulation of biological process
GO:0048523	0.939	negative regulation of cellular process
GO:0048522	0.922	positive regulation of cellular process
GO:0031326	0.909	regulation of cellular biosynthetic process
GO:0051246	0.896	regulation of protein metabolic process
GO:0010556	0.895	regulation of macromolecule biosynthetic process
GO:0016310	0.867	phosphorylation
GO:0009893	0.840	positive regulation of metabolic process
GO:0006109	0.761	regulation of carbohydrate metabolic process
GO:0010604	0.760	positive regulation of macromolecule metabolic process
GO:0010675	0.752	regulation of cellular carbohydrate metabolic process
GO:0032881	0.746	regulation of polysaccharide metabolic process
GO:0009892	0.737	negative regulation of metabolic process
GO:0051173	0.675	positive regulation of nitrogen compound metabolic process
GO:0043467	0.651	regulation of generation of precursor metabolites and energy
GO:0006468	0.648	protein phosphorylation
GO:0010608	0.633	post-transcriptional regulation of gene expression
GO:2000112	0.631	regulation of cellular macromolecule biosynthetic process
GO:0010962	0.608	regulation of glucan biosynthetic process
GO:0006417	0.608	regulation of translation
GO:0070873	0.589	regulation of glycogen metabolic process
GO:0031325	0.551	positive regulation of cellular metabolic process
GO:0005979	0.527	regulation of glycogen biosynthetic process
GO:0010605	0.447	negative regulation of macromolecule metabolic process
GO:0031324	0.433	negative regulation of cellular metabolic process
GO:0045912	0.384	negative regulation of carbohydrate metabolic process
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0050896	0.349	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0070013	0.379	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]