StarFunc result for job id Q96RI1

User Input

>input (486 residues)
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEG
RDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60641	0.713	0.710	1.301E-53	488	0.928	0.924	Q60641.pdb.gz	NR1H4_MOUSE Bile acid receptor OS=Mus musculus OX=10090 GN=Nr1h4 PE=1 SV=3
2	AFDB:A0A2R8QR22	0.536	0.539	3.144E-42	483	0.628	0.631	A0A2R8QR22.pdb.gz
3	AFDB:Q8JHU1	0.441	0.518	4.818E-25	409	0.302	0.359	Q8JHU1.pdb.gz	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
4	AFDB:B4DXU5	0.466	0.498	9.931E-25	453	0.319	0.342	B4DXU5.pdb.gz	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
5	AFDB:A0A060WYW4	0.452	0.473	1.282E-24	462	0.327	0.344	A0A060WYW4.pdb.gz	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
6	AFDB:F1D8P7	0.425	0.447	3.411E-24	461	0.300	0.317	F1D8P7.pdb.gz	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
7	AFDB:Q62685	0.427	0.464	1.793E-23	445	0.313	0.342	Q62685.pdb.gz	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
8	AFDB:A0A0R4IVP0	0.432	0.474	2.126E-23	441	0.305	0.336	A0A0R4IVP0.pdb.gz	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
9	AFDB:O18473	0.413	0.351	2.115E-22	576	0.327	0.276	O18473.pdb.gz	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
10	AFDB:Q7ZTI3	0.426	0.451	1.312E-20	458	0.249	0.264	Q7ZTI3.pdb.gz	RARAB_DANRE Retinoic acid receptor alpha-B OS=Danio rerio OX=7955 GN=rarab PE=2 SV=1
11	PDB:3dzyA	0.364	0.570	8.244E-13	302	0.189	0.305	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.413	0.814	3.324E-10	238	0.134	0.273	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.312	0.600	8.311E-6	246	0.097	0.191	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.350	0.623	2.021E-4	259	0.080	0.151	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7kzqE	0.099	0.110	6.020E-1	419	0.068	0.079	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
16	PDB:6r4vC	0.141	0.204	6.555E-1	294	0.072	0.119	6r4vC.pdb.gz	Metal Coordination Is Crucial for Geranylgeranyl Diphosphate Synthase-Bisphosphonate Interactions: A Crystallographic and Computational Analysis.
17	PDB:6xz6A	0.106	0.202	7.771E-1	213	0.047	0.108	6xz6A.pdb.gz
18	PDB:6c56B	0.106	0.160	9.613E-1	267	0.068	0.124	6c56B.pdb.gz	Unraveling the Prenylation-Cancer Paradox in Multiple Myeloma with Novel Geranylgeranyl Pyrophosphate Synthase (GGPPS) Inhibitors.
19	PDB:7ew2R	0.111	0.163	1.295	290	0.045	0.076	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
20	PDB:7wtww	0.093	0.122	1.535	332	0.099	0.145	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q60641	0.0	936	488	0.928	0.924	NR1H4_MOUSE Bile acid receptor OS=Mus musculus OX=10090 GN=Nr1h4 PE=1 SV=3
2	Q62735	0.0	878	469	0.858	0.889	NR1H4_RAT Bile acid receptor OS=Rattus norvegicus OX=10116 GN=Nr1h4 PE=1 SV=1
3	Q6DGW7	0.0	608	483	0.636	0.640	Q6DGW7_DANRE Bile acid receptor OS=Danio rerio OX=7955 GN=zgc:92742 PE=2 SV=1
4	Q96RI1	0.0	1021	486	1.000	1.000	NR1H4_HUMAN Bile acid receptor OS=Homo sapiens OX=9606 GN=NR1H4 PE=1 SV=2
5	A0A060WYW4	1.18e-85	273	462	0.352	0.370	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
6	B8Y3M1	1.30e-85	273	462	0.352	0.370	B8Y3M1_ONCMY Liver X receptor OS=Oncorhynchus mykiss OX=8022 GN=LXR PE=2 SV=1
7	A0A060VSG9	1.62e-85	271	425	0.315	0.360	A0A060VSG9_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064070001 PE=3 SV=1
8	A0A0R4IVP0	2.00e-85	271	441	0.309	0.340	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
9	Q8JHU1	2.18e-83	265	409	0.315	0.374	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
10	Q9Z0Y9	6.59e-83	265	445	0.311	0.339	NR1H3_MOUSE Oxysterols receptor LXR-alpha OS=Mus musculus OX=10090 GN=Nr1h3 PE=1 SV=3
11	F1D8N1	8.32e-82	262	447	0.313	0.340	F1D8N1_HUMAN Liver X nuclear receptor alpha variant 1 OS=Homo sapiens OX=9606 GN=NR1H3 PE=2 SV=1
12	Q13133	8.32e-82	262	447	0.313	0.340	NR1H3_HUMAN Oxysterols receptor LXR-alpha OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=2
13	B4DXU5	1.93e-81	261	453	0.313	0.336	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
14	Q62685	2.16e-80	258	445	0.309	0.337	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
15	P55055	5.12e-73	240	460	0.290	0.307	NR1H2_HUMAN Oxysterols receptor LXR-beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=2
16	Q60644	1.04e-70	233	446	0.282	0.307	NR1H2_MOUSE Oxysterols receptor LXR-beta OS=Mus musculus OX=10090 GN=Nr1h2 PE=1 SV=1
17	Q62755	3.70e-70	232	446	0.290	0.316	NR1H2_RAT Oxysterols receptor LXR-beta OS=Rattus norvegicus OX=10116 GN=Nr1h2 PE=2 SV=1
18	O18473	4.77e-63	216	576	0.294	0.248	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
19	P34021	4.06e-62	219	878	0.311	0.172	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
20	Q9PTN2	1.74e-52	185	453	0.245	0.263	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	6.9e-23	92.9	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	3.6e-25	99.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385216	0.997	Nuclear receptor coactivator 1
2	9606.ENSP00000419692	0.992	Retinoic acid receptor RXR-alpha
3	9606.ENSP00000301645	0.988	Cholesterol 7-alpha-monooxygenase
4	9606.ENSP00000254227	0.978	Nuclear receptor subfamily 0 group B member 2
5	9606.ENSP00000377549	0.976	Gastrotropin
6	9606.ENSP00000363817	0.953	Retinoic acid receptor RXR-beta
7	9606.ENSP00000264867	0.946	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
8	9606.ENSP00000399968	0.944	Nuclear receptor coactivator 2
9	9606.ENSP00000430886	0.943	G-protein coupled bile acid receptor 1
10	9606.ENSP00000300651	0.940	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000268712	0.939	Nuclear receptor corepressor 1
12	9606.ENSP00000352900	0.937	Retinoic acid receptor RXR-gamma
13	9606.ENSP00000292408	0.925	Fibroblast growth factor receptor 4
14	9606.ENSP00000294312	0.906	Fibroblast growth factor 19
15	9606.ENSP00000296327	0.906	Organic solute transporter subunit alpha
16	9606.ENSP00000348056	0.905	SUMO-conjugating enzyme UBC9
17	9606.ENSP00000263817	0.903	Bile salt export pump
18	9606.ENSP00000387699	0.898	Cyclic AMP-responsive element-binding protein 1
19	9606.ENSP00000406162	0.890	Protein arginine N-methyltransferase 1
20	9606.ENSP00000376077	0.872	Small ubiquitin-related modifier 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004879	1.000	nuclear receptor activity
GO:0032052	0.999	bile acid binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0016922	0.998	nuclear receptor binding
GO:0003677	0.995	DNA binding
GO:0043565	0.967	sequence-specific DNA binding
GO:0003690	0.929	double-stranded DNA binding
GO:1990837	0.863	sequence-specific double-stranded DNA binding
GO:0001067	0.854	transcription regulatory region nucleic acid binding
GO:0000976	0.572	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0080090	0.994	regulation of primary metabolic process
GO:0009893	0.992	positive regulation of metabolic process
GO:0050896	0.991	response to stimulus
GO:0009889	0.990	regulation of biosynthetic process
GO:0009987	0.987	cellular process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0009891	0.981	positive regulation of biosynthetic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0031326	0.968	regulation of cellular biosynthetic process
GO:0048522	0.958	positive regulation of cellular process
GO:2001141	0.957	regulation of RNA biosynthetic process
GO:0006355	0.950	regulation of DNA-templated transcription
GO:0010557	0.948	positive regulation of macromolecule biosynthetic process
GO:0031328	0.947	positive regulation of cellular biosynthetic process
GO:0045935	0.947	positive regulation of nucleobase-containing compound metabolic process
GO:0071704	0.924	organic substance metabolic process
GO:0045893	0.899	positive regulation of DNA-templated transcription
GO:0048519	0.893	negative regulation of biological process
GO:0042221	0.886	response to chemical
GO:0044238	0.872	primary metabolic process
GO:0051716	0.812	cellular response to stimulus
GO:0048523	0.793	negative regulation of cellular process
GO:0006357	0.792	regulation of transcription by RNA polymerase II
GO:0045944	0.768	positive regulation of transcription by RNA polymerase II
GO:0010033	0.748	response to organic substance
GO:0048583	0.745	regulation of response to stimulus
GO:0009892	0.735	negative regulation of metabolic process
GO:0044237	0.728	cellular metabolic process
GO:0032879	0.721	regulation of localization
GO:0007154	0.715	cell communication
GO:0010646	0.705	regulation of cell communication
GO:0030522	0.703	intracellular receptor signaling pathway
GO:1901700	0.649	response to oxygen-containing compound
GO:0042592	0.638	homeostatic process
GO:0023051	0.636	regulation of signaling
GO:0055088	0.609	lipid homeostasis
GO:0051049	0.538	regulation of transport
GO:0006807	0.493	nitrogen compound metabolic process
GO:0070887	0.493	cellular response to chemical stimulus
GO:0014070	0.431	response to organic cyclic compound
GO:1901360	0.426	organic cyclic compound metabolic process
GO:0010605	0.410	negative regulation of macromolecule metabolic process
GO:0032501	0.398	multicellular organismal process
GO:0051239	0.379	regulation of multicellular organismal process
GO:0044281	0.334	small molecule metabolic process
GO:0006629	0.332	lipid metabolic process
GO:0051179	0.319	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.992	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0005737	0.840	cytoplasm
GO:0005694	0.702	chromosome
GO:0000785	0.662	chromatin
GO:0016020	0.640	membrane
GO:0043235	0.320	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]