StarFunc result for job id Q96RJ3

User Input

>input (184 residues)
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RJ3	0.999	0.999	1.978E-27	184	1.000	1.000	Q96RJ3.pdb.gz	TR13C_HUMAN Tumor necrosis factor receptor superfamily member 13C OS=Homo sapiens OX=9606 GN=TNFRSF13C PE=1 SV=1
2	AFDB:Q9D8D0	0.227	0.238	3.111E-12	175	0.538	0.566	Q9D8D0.pdb.gz	TR13C_MOUSE Tumor necrosis factor receptor superfamily member 13C OS=Mus musculus OX=10090 GN=Tnfrsf13c PE=1 SV=1
3	AFDB:O14369	0.142	0.084	2.621E-2	388	0.207	0.098	O14369.pdb.gz	SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sce3 PE=1 SV=1
4	AFDB:E7EYL3	0.189	0.050	1.341E-1	971	0.109	0.021	E7EYL3.pdb.gz
5	AFDB:O60500	0.236	0.042	1.781E-1	1241	0.174	0.026	O60500.pdb.gz	NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1
6	AFDB:F1RAS9	0.192	0.089	2.540E-1	425	0.179	0.078	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
7	AFDB:Q9UKJ1	0.202	0.132	2.927E-1	303	0.147	0.089	Q9UKJ1.pdb.gz	PILRA_HUMAN Paired immunoglobulin-like type 2 receptor alpha OS=Homo sapiens OX=9606 GN=PILRA PE=1 SV=3
8	AFDB:O35227	0.217	0.059	4.811E-1	789	0.141	0.033	O35227.pdb.gz	ADAM7_MOUSE Disintegrin and metalloproteinase domain-containing protein 7 OS=Mus musculus OX=10090 GN=Adam7 PE=1 SV=2
9	AFDB:P43146	0.193	0.035	4.811E-1	1447	0.185	0.023	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
10	AFDB:Q9R187	0.160	0.084	4.811E-1	448	0.168	0.069	Q9R187.pdb.gz	EDAR_MOUSE Tumor necrosis factor receptor superfamily member EDAR OS=Mus musculus OX=10090 GN=Edar PE=1 SV=1
11	PDB:4bxwB	0.085	0.055	6.112	287	0.022	0.014	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RJ3	4.89e-125	351	184	1.000	1.000	TR13C_HUMAN Tumor necrosis factor receptor superfamily member 13C OS=Homo sapiens OX=9606 GN=TNFRSF13C PE=1 SV=1
2	Q9D8D0	1.50e-38	132	175	0.549	0.577	TR13C_MOUSE Tumor necrosis factor receptor superfamily member 13C OS=Mus musculus OX=10090 GN=Tnfrsf13c PE=1 SV=1
3	Q02223	0.11	34.7	184	0.228	0.228	TNR17_HUMAN Tumor necrosis factor receptor superfamily member 17 OS=Homo sapiens OX=9606 GN=TNFRSF17 PE=1 SV=2
4	Q3UU41	0.63	32.0	150	0.158	0.193	SCIMP_MOUSE SLP adapter and CSK-interacting membrane protein OS=Mus musculus OX=10090 GN=Scimp PE=1 SV=1
5	Q62205	0.74	32.7	1984	0.130	0.012	SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus OX=10090 GN=Scn9a PE=1 SV=2
6	Q6RKD8	1.0	32.3	646	0.125	0.036	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
7	U6A022	1.0	32.3	808	0.114	0.026	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
8	Q9NZU1	1.2	32.0	646	0.125	0.036	FLRT1_HUMAN Leucine-rich repeat transmembrane protein FLRT1 OS=Homo sapiens OX=9606 GN=FLRT1 PE=1 SV=3
9	Q8VHH5	1.4	32.0	910	0.114	0.023	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
10	P70398	1.7	31.6	2559	0.087	0.006	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
11	Q93008	1.9	31.6	2554	0.087	0.006	USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4
12	O88472	2.7	30.4	185	0.174	0.173	TNR17_MOUSE Tumor necrosis factor receptor superfamily member 17 OS=Mus musculus OX=10090 GN=Tnfrsf17 PE=2 SV=1
13	Q9VGM1	4.0	30.4	1316	0.109	0.015	Q9VGM1_DROME Multidrug resistance protein 4 OS=Drosophila melanogaster OX=7227 GN=Mrp4 PE=1 SV=2
14	F1R3C6	4.1	30.4	1855	0.082	0.008	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
15	F1LRS8	5.2	30.0	637	0.065	0.019	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
16	Q80ZE7	5.5	30.0	637	0.065	0.019	Q80ZE7_RAT CD2AP/CMS OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=2 SV=1
17	O74755	5.9	30.0	1154	0.071	0.011	PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst3 PE=1 SV=1
18	Q03763	6.2	30.0	1043	0.087	0.015	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
19	Q5VYH9	7.2	29.6	565	0.103	0.034	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
20	Q9HBG7	7.4	29.6	655	0.103	0.029	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09256 BaffR-Tall_bind	3.5e-14	63.5	BAFF-R, TALL-1 binding
2	PF13301 DUF4079	2.8e+02	13.1	Protein of unknown function (DUF4079)
3	PF14316 DUF4381	1.7e+02	13.9	Domain of unknown function (DUF4381)
4	PF20176 DUF6541	52	13.6	Family of unknown function (DUF6541)
5	PF15330 SIT	1.8e+02	14.0	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291232

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365048	0.999	Tumor necrosis factor ligand superfamily member 13B
2	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
3	9606.ENSP00000261652	0.990	Tumor necrosis factor receptor superfamily member 13B
4	9606.ENSP00000053243	0.977	Tumor necrosis factor receptor superfamily member 17
5	9606.ENSP00000247668	0.912	TNF receptor-associated factor 2
6	9606.ENSP00000361359	0.895	Tumor necrosis factor receptor superfamily member 5
7	9606.ENSP00000359663	0.870	CD40 ligand
8	9606.ENSP00000228918	0.869	Tumor necrosis factor receptor superfamily member 3
9	9606.ENSP00000433623	0.853	TNF receptor-associated factor 6
10	9606.ENSP00000398698	0.847	Tumor necrosis factor
11	9606.ENSP00000477613	0.844	Baculoviral IAP repeat-containing protein 2
12	9606.ENSP00000293825	0.798	Tumor necrosis factor ligand superfamily member 12
13	9606.ENSP00000306884	0.794	C-X-C motif chemokine 11
14	9606.ENSP00000297156	0.787	Calcium signal-modulating cyclophilin ligand
15	9606.ENSP00000482657	0.785	Mitogen-activated protein kinase kinase kinase 14
16	9606.ENSP00000326737	0.778	Tumor necrosis factor receptor superfamily member 12A
17	9606.ENSP00000362994	0.750	TNF receptor-associated factor 1
18	9606.ENSP00000292174	0.743	C-X-C chemokine receptor type 5
19	9606.ENSP00000343505	0.738	Tumor necrosis factor ligand superfamily member 13
20	9606.ENSP00000437940	0.728	B-lymphocyte antigen CD19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0050896	0.957	response to stimulus
GO:0048518	0.951	positive regulation of biological process
GO:0048522	0.936	positive regulation of cellular process
GO:0051239	0.849	regulation of multicellular organismal process
GO:0051240	0.799	positive regulation of multicellular organismal process
GO:0002682	0.793	regulation of immune system process
GO:0051716	0.787	cellular response to stimulus
GO:0048583	0.770	regulation of response to stimulus
GO:0002376	0.752	immune system process
GO:0007154	0.725	cell communication
GO:0007165	0.723	signal transduction
GO:0019222	0.685	regulation of metabolic process
GO:0042127	0.633	regulation of cell population proliferation
GO:0060255	0.618	regulation of macromolecule metabolic process
GO:0002684	0.584	positive regulation of immune system process
GO:0050865	0.567	regulation of cell activation
GO:0051249	0.560	regulation of lymphocyte activation
GO:0010468	0.505	regulation of gene expression
GO:0009893	0.492	positive regulation of metabolic process
GO:0010604	0.476	positive regulation of macromolecule metabolic process
GO:0048584	0.459	positive regulation of response to stimulus
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.614	intracellular anatomical structure
GO:0043231	0.468	intracellular membrane-bounded organelle
GO:0005737	0.379	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]