StarFunc result for job id Q96RJ6

User Input

>input (166 residues)
MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RJ6	1.000	1.000	3.188E-25	166	1.000	1.000	Q96RJ6.pdb.gz	FER3L_HUMAN Fer3-like protein OS=Homo sapiens OX=9606 GN=FERD3L PE=1 SV=1
2	AFDB:Q923Z4	0.543	0.537	3.521E-17	168	0.789	0.780	Q923Z4.pdb.gz	FER3L_MOUSE Fer3-like protein OS=Mus musculus OX=10090 GN=Ferd3l PE=1 SV=1
3	AFDB:Q568M7	0.368	0.362	1.479E-4	169	0.253	0.249	Q568M7.pdb.gz	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
4	AFDB:Q7ZSX3	0.399	0.258	1.793E-4	265	0.295	0.185	Q7ZSX3.pdb.gz	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1
5	AFDB:Q7RTS3	0.364	0.189	3.638E-4	328	0.343	0.174	Q7RTS3.pdb.gz	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
6	AFDB:Q6NYU3	0.358	0.198	3.880E-4	327	0.289	0.147	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
7	AFDB:A1MB48	0.377	0.390	5.018E-4	160	0.235	0.244	A1MB48.pdb.gz
8	AFDB:A0FH50	0.370	0.335	5.706E-4	184	0.259	0.234	A0FH50.pdb.gz	A0FH50_DANRE Basic helix-loop-helix family, member a15 OS=Danio rerio OX=7955 GN=mist1 PE=2 SV=1
9	AFDB:P13903	0.395	0.395	5.706E-4	166	0.253	0.253	P13903.pdb.gz	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
10	AFDB:Q9PTE3	0.389	0.378	5.706E-4	171	0.259	0.251	Q9PTE3.pdb.gz	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
11	PDB:6lo8E	0.203	0.371	9.754E-1	80	0.048	0.100	6lo8E.pdb.gz
12	PDB:2bskD	0.195	0.306	1.261	90	0.096	0.178	2bskD.pdb.gz
13	PDB:6lo8H	0.199	0.370	1.979	74	0.060	0.135	6lo8H.pdb.gz
14	PDB:6zx9C	0.137	0.099	2.400	257	0.102	0.066	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
15	PDB:7nacI	0.161	0.050	3.310	533	0.102	0.032	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:7suk5	0.210	0.127	4.281	296	0.078	0.044	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:3s5oA	0.114	0.068	5.536	296	0.042	0.024	3s5oA.pdb.gz
18	PDB:2q0oD	0.175	0.314	5.904	87	0.054	0.103	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
19	PDB:5mpsR	0.146	0.201	6.296	108	0.060	0.093	5mpsR.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
20	PDB:2bskC	0.178	0.323	7.160	79	0.024	0.051	2bskC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RJ6	1.25e-117	331	166	1.000	1.000	FER3L_HUMAN Fer3-like protein OS=Homo sapiens OX=9606 GN=FERD3L PE=1 SV=1
2	Q923Z4	3.22e-78	231	168	0.789	0.780	FER3L_MOUSE Fer3-like protein OS=Mus musculus OX=10090 GN=Ferd3l PE=1 SV=1
3	Q9VEY3	2.44e-18	81.3	274	0.235	0.142	Q9VEY3_DROME 48 related 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Fer2 PE=4 SV=2
4	A0A0B4LH77	2.73e-18	81.3	273	0.235	0.143	A0A0B4LH77_DROME 48 related 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Fer2 PE=4 SV=1
5	Q7ZSX3	4.64e-18	80.5	265	0.253	0.158	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1
6	Q7RTS3	1.43e-17	80.1	328	0.205	0.104	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
7	Q64305	1.53e-17	80.1	326	0.205	0.104	PTF1A_RAT Pancreas transcription factor 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Ptf1a PE=1 SV=1
8	Q9QX98	1.66e-17	79.7	324	0.205	0.105	PTF1A_MOUSE Pancreas transcription factor 1 subunit alpha OS=Mus musculus OX=10090 GN=Ptf1a PE=1 SV=1
9	A0A0B4LIA7	1.76e-17	79.3	279	0.235	0.140	A0A0B4LIA7_DROME 48 related 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Fer2 PE=4 SV=1
10	A0A0B4LH78	5.36e-17	77.8	283	0.235	0.138	A0A0B4LH78_DROME 48 related 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Fer2 PE=4 SV=1
11	Q20561	5.89e-16	72.4	147	0.205	0.231	HLH13_CAEEL Helix-loop-helix protein 13 OS=Caenorhabditis elegans OX=6239 GN=hlh-13 PE=2 SV=1
12	P48985	5.67e-15	73.2	351	0.205	0.097	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
13	Q92858	6.35e-15	72.8	354	0.205	0.096	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
14	B0R059	1.67e-14	71.2	292	0.187	0.106	B0R059_DANRE Atonal bHLH transcription factor 1a OS=Danio rerio OX=7955 GN=Atoh1.1 PE=4 SV=1
15	B3DH94	2.54e-14	69.7	206	0.205	0.165	B3DH94_DANRE Atonal bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=Atoh1.2 PE=2 SV=1
16	F1QWM8	1.98e-13	68.6	348	0.205	0.098	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
17	P48987	4.53e-13	67.4	312	0.229	0.122	ATO_DROME Protein atonal OS=Drosophila melanogaster OX=7227 GN=ato PE=1 SV=2
18	Q62414	3.64e-12	65.1	383	0.187	0.081	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
19	Q9HD90	4.15e-12	64.7	331	0.193	0.097	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
20	Q15784	4.28e-12	65.1	382	0.187	0.081	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	5.7e-14	63.2	Helix-loop-helix DNA-binding domain
2	PF19722 SENP3_5_N	3.8e+02	11.5	Sentrin-specific protease 3/5 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398789	0.799	Sorting nexin-13
2	9606.ENSP00000381382	0.757	Transcription factor 4
3	9606.ENSP00000388940	0.755	Transcription factor 12
4	9606.ENSP00000262965	0.707	Transcription factor E2-alpha
5	9606.ENSP00000358807	0.699	Homeobox protein aristaless-like 3
6	9606.ENSP00000254963	0.686	Heat shock protein family A member 12B
7	9606.ENSP00000411827	0.653	Integral membrane protein GPR137
8	9606.ENSP00000317331	0.628	Translocon-associated protein subunit delta
9	9606.ENSP00000319281	0.591	Brain abundant membrane attached signal protein 1
10	9606.ENSP00000333982	0.578	Nuclear distribution protein nudE-like 1
11	9606.ENSP00000302276	0.574	Protein HEXIM2
12	9606.ENSP00000222567	0.567	DNA-directed RNA polymerase I subunit RPA43
13	9606.ENSP00000451974	0.564	DNA repair protein XRCC3
14	9606.ENSP00000400341	0.563	Hepatocyte nuclear factor 3-beta
15	9606.ENSP00000222402	0.561	Ubiquitin-conjugating enzyme E2 D4
16	9606.ENSP00000357206	0.527	Nestin
17	9606.ENSP00000256969	0.512	Spexin
18	9606.ENSP00000287907	0.512	5-hydroxytryptamine receptor 5A
19	9606.ENSP00000295454	0.512	Gamma-aminobutyric acid receptor subunit beta-1
20	9606.ENSP00000420976	0.512	Leukemia-associated protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.950	transcription regulator activity
GO:0001067	0.947	transcription regulatory region nucleic acid binding
GO:0003700	0.939	DNA-binding transcription factor activity
GO:0000976	0.937	transcription cis-regulatory region binding
GO:0000977	0.743	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.447	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0010468	0.962	regulation of gene expression
GO:0031326	0.959	regulation of cellular biosynthetic process
GO:0010556	0.958	regulation of macromolecule biosynthetic process
GO:0006355	0.953	regulation of DNA-templated transcription
GO:0048856	0.931	anatomical structure development
GO:0032501	0.920	multicellular organismal process
GO:0007275	0.906	multicellular organism development
GO:0048731	0.819	system development
GO:0009987	0.772	cellular process
GO:0006357	0.734	regulation of transcription by RNA polymerase II
GO:0007399	0.523	nervous system development
GO:0048523	0.468	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.779	intracellular organelle lumen
GO:0031981	0.709	nuclear lumen
GO:0043232	0.622	intracellular non-membrane-bounded organelle
GO:0005654	0.479	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]