StarFunc result for job id Q96RK0

User Input

>input (1608 residues)
MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQ
PASHPVASNQSKEPAESAAVAHERPPGGTGSADPERPPGATCPESPGPGPPHPLGVVESG
KGPPPTTEEEASGPPGEPRLDSETESDHDDAFLSIMSPEIQLPLPPGKRRTQSLSALPKE
RDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYA
LGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEAKPTSLGLAGGHKETRERSM
SETGTAAAPGVSSELLSVAAQTLLSSDTKAPGSSSCGAERLHTVGGPGSARPRAFSHSGV
HSLDGGEVDSQALQELTQMVSGPASYSGPKPSTQYGAPGPFAAPGEGGALAATGRPPLLP
TRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDGFGTTDIDLKCKERVTDSESGDSS
GEDPEGNKGFGRKVFSPVIRSSFTHCRPPLDPEPPGPPDPPVAFGKGYGSAPSSSASSPA
SSSASAATSFSLGSGTFKAQESGQGSTAGPLRPPPPGAGGPATPSKATRFLPMDPATFRR
KRPESVGGLEPPGPSVIAAPPSGGGNILQTLVLPPNKEEQEGGGARVPSAPAPSLAYGAP
AAPLSRPAATMVTNVVRPVSSTPVPIASKPFPTSGRAEASPNDTAGARTEMGTGSRVPGG
SPLGVSLVYSDKKSAAATSPAPHLVAGPLLGTVGKAPATVTNLLVGTPGYGAPAPPAVQF
IAQGAPGGGTTAGSGAGAGSGPNGPVPLGILQPGALGKAGGITQVQYILPTLPQQLQVAP
APAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTNGKVLAATAPTPGIPILQSVPSAPPPKA
QSVSPVQAPPPGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSPPFSVPVQNGAQPP
SKIIQLTPVPVSTPSGLVPPLSPATLPGPTSQPQKVLLPSSTRITYVQSAGGHALPLGTS
PASSQAGTVTSYGPTSSVALGFTSLGPSGPAFVQPLLSAGQAPLLAPGQVGVSPVPSPQL
PPACAAPGGPVITAFYSGSPAPTSSAPLAQPSQAPPSLVYTVATSTTPPAATILPKGPPA
PATATPAPTSPFPSATAGSMTYSLVAPKAQRPSPKAPQKVKAAIASIPVGSFEAGASGRP
GPAPRQPLEPGPVREPTAPESELEGQPTPPAPPPLPETWTPTARSSPPLPPPAEERTSAK
GPETMASKFPSSSSDWRVPGQGLENRGEPPTPPSPAPAPAVAPGGSSESSSGRAAGDTPE
RKEAAGTGKKVKVRPPPLKKTFDSVDNRVLSEVDFEERFAELPEFRPEEVLPSPTLQSLA
TSPRAILGSYRKKRKNSTDLDSAPEDPTSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFD
RTGTEAEDVLGELEYDKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADI
FPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPVPPPTGTAAAPAPTPSPAGGPDPT
SPSSDSGTAQAAPPLPPPPESGPGQPGWEGAPQPSPPPPGPSTAATGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924A2	0.118	0.083	0.000	2510	0.910	0.583	Q924A2.pdb.gz	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
2	AFDB:F1Q6M9	0.074	0.051	1.135E-49	2623	0.428	0.262	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
3	AFDB:Q9U1H0	0.076	0.068	4.194E-27	1832	0.215	0.189	Q9U1H0.pdb.gz	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
4	AFDB:M9PGK7	0.042	0.034	3.440E-4	2272	0.150	0.107	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
5	AFDB:Q8MSX1	0.038	0.037	5.975E-4	1818	0.159	0.141	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
6	AFDB:E9Q4F7	0.032	0.022	9.181E-4	2643	0.147	0.090	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
7	PDB:1j5nA	0.043	0.626	1.943E-3	93	0.016	0.269	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
8	AFDB:Q6UB99	0.037	0.026	4.002E-3	2663	0.158	0.095	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
9	AFDB:O42854	0.029	0.030	8.886E-3	1611	0.148	0.148	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
10	AFDB:E2QD98	0.028	0.026	1.452E-2	2020	0.129	0.102	E2QD98.pdb.gz	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
11	AFDB:Q14966	0.044	0.039	1.745E-2	1978	0.136	0.111	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
12	PDB:6z1bB	0.034	0.207	1.465	202	0.007	0.054	6z1bB.pdb.gz	Structure of K52-acetylated RutR in complex with uracil.
13	PDB:6wkrC	0.027	0.059	1.558	606	0.019	0.050	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
14	PDB:4ifdH	0.028	0.116	2.394	295	0.007	0.037	4ifdH.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
15	PDB:2jj7B	0.029	0.188	2.545	183	0.006	0.055	2jj7B.pdb.gz
16	PDB:6d6qH	0.028	0.119	2.877	289	0.006	0.031	6d6qH.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
17	PDB:5a1vK	0.025	0.034	3.060	1126	0.007	0.010	5a1vK.pdb.gz
18	PDB:3j79b	0.030	0.317	3.253	95	0.003	0.053	3j79b.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
19	PDB:7ktsF	0.026	0.089	3.459	351	0.017	0.080	7ktsF.pdb.gz
20	PDB:7rro2	0.022	0.089	3.459	292	0.014	0.079	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQR4	0.0	3103	1606	0.999	1.000	A0A0A0MQR4_HUMAN Capicua transcriptional repressor OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=1
2	Q924A2	0.0	2516	2510	0.899	0.576	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
3	Q96RK0	0.0	3116	1608	1.000	1.000	CIC_HUMAN Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2
4	F1Q6M9	1.30e-121	427	2623	0.163	0.100	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
5	Q9U1H0	2.34e-38	160	1832	0.038	0.033	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
6	C9J8D0	5.41e-25	112	448	0.032	0.116	C9J8D0_HUMAN BBX high mobility group box domain containing (Fragment) OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
7	C9JA69	7.94e-25	115	891	0.032	0.058	C9JA69_HUMAN BBX high mobility group box domain containing OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
8	Q8VBW5	8.27e-25	115	907	0.032	0.056	BBX_MOUSE HMG box transcription factor BBX OS=Mus musculus OX=10090 GN=Bbx PE=1 SV=2
9	Q8WY36	1.46e-24	114	941	0.032	0.055	BBX_HUMAN HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
10	Q9UN79	1.12e-13	78.6	622	0.028	0.072	SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3
11	Q04891	1.14e-13	78.6	613	0.030	0.080	SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus OX=10090 GN=Sox13 PE=1 SV=4
12	Q9W7R6	1.80e-12	71.2	240	0.020	0.133	SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus OX=9031 GN=SOX14 PE=2 SV=1
13	F1M8W4	1.85e-12	74.7	763	0.021	0.043	SOX5_RAT Transcription factor SOX-5 OS=Rattus norvegicus OX=10116 GN=Sox5 PE=1 SV=2
14	O95416	1.93e-12	71.2	240	0.020	0.133	SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens OX=9606 GN=SOX14 PE=1 SV=1
15	Q04892	1.96e-12	71.2	240	0.020	0.133	SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus OX=10090 GN=Sox14 PE=2 SV=2
16	P35710	2.25e-12	74.3	763	0.021	0.043	SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus OX=10090 GN=Sox5 PE=1 SV=2
17	P35711	2.60e-12	74.3	763	0.021	0.043	SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens OX=9606 GN=SOX5 PE=1 SV=3
18	Q17922	2.73e-12	70.5	224	0.022	0.156	Q17922_CAEEL HMG box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sox-4 PE=4 SV=3
19	Q32PP9	3.30e-12	70.5	238	0.020	0.134	SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio OX=7955 GN=sox14 PE=2 SV=1
20	Q20201	3.31e-12	69.7	212	0.022	0.165	SOX3_CAEEL Transcription factor sox-3 OS=Caenorhabditis elegans OX=6239 GN=sox-3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	2e-13	61.9	HMG (high mobility group) box
2	PF09011 HMG_box_2	0.0017	30.2	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244769	0.994	Ataxin-1
2	9606.ENSP00000388638	0.890	Splicing factor 45
3	9606.ENSP00000415822	0.712	Ataxin-1-like
4	9606.ENSP00000365201	0.656	Protein PRRC2A
5	9606.ENSP00000359804	0.620	Far upstream element-binding protein 1
6	9606.ENSP00000484656	0.595	MyoD family inhibitor domain-containing protein
7	9606.ENSP00000315136	0.588	Amyloid-beta A4 precursor protein-binding family A member 3
8	9606.ENSP00000357292	0.565	Ubiquilin-4
9	9606.ENSP00000297661	0.545	Ubiquitin-associated protein 1
10	9606.ENSP00000262177	0.537	DnaJ homolog subfamily B member 6
11	9606.ENSP00000218224	0.535	Polyglutamine-binding protein 1
12	9606.ENSP00000342235	0.522	Receptor tyrosine-protein kinase erbB-4
13	9606.ENSP00000302189	0.520	Helix-loop-helix protein 1
14	9606.ENSP00000349076	0.517	Atrophin-1
15	9606.ENSP00000451207	0.515	Double homeobox 4 like 1
16	9606.ENSP00000458065	0.514	Double homeobox protein 4
17	9606.ENSP00000351619	0.509	Phenazine biosynthesis like protein domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.921	nucleic acid binding
GO:0003677	0.782	DNA binding
GO:0003682	0.520	chromatin binding
GO:0140110	0.490	transcription regulator activity
GO:0043565	0.342	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0009987	0.967	cellular process
GO:0010468	0.963	regulation of gene expression
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.945	regulation of biosynthetic process
GO:0031326	0.942	regulation of cellular biosynthetic process
GO:0048523	0.935	negative regulation of cellular process
GO:0006355	0.933	regulation of DNA-templated transcription
GO:0051172	0.746	negative regulation of nitrogen compound metabolic process
GO:0008152	0.736	metabolic process
GO:0010605	0.720	negative regulation of macromolecule metabolic process
GO:0048518	0.715	positive regulation of biological process
GO:0006357	0.700	regulation of transcription by RNA polymerase II
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0044237	0.666	cellular metabolic process
GO:0031324	0.655	negative regulation of cellular metabolic process
GO:0071704	0.570	organic substance metabolic process
GO:0044238	0.533	primary metabolic process
GO:0045934	0.529	negative regulation of nucleobase-containing compound metabolic process
GO:0006807	0.523	nitrogen compound metabolic process
GO:0043170	0.523	macromolecule metabolic process
GO:0031327	0.479	negative regulation of cellular biosynthetic process
GO:1903507	0.466	negative regulation of nucleic acid-templated transcription
GO:0045892	0.464	negative regulation of DNA-templated transcription
GO:0048522	0.462	positive regulation of cellular process
GO:0031325	0.443	positive regulation of cellular metabolic process
GO:0051173	0.436	positive regulation of nitrogen compound metabolic process
GO:0050896	0.355	response to stimulus
GO:0032502	0.355	developmental process
GO:0007275	0.346	multicellular organism development
GO:0048513	0.334	animal organ development
GO:0000122	0.311	negative regulation of transcription by RNA polymerase II
GO:0048731	0.304	system development
GO:0045935	0.301	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.512	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]