StarFunc result for job id Q96RL1

User Input

>input (719 residues)
MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKT
KTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNS
CRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEERE
EPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRG
SAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQL
EVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEE
RQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQ
SVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADK
EVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKE
AKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRA
CSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAG
CSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7R0	0.170	0.170	9.854E-98	719	1.000	1.000	A0A024R7R0.pdb.gz
2	AFDB:Q5U5Q9	0.236	0.234	5.761E-76	727	0.765	0.757	Q5U5Q9.pdb.gz	UIMC1_MOUSE BRCA1-A complex subunit RAP80 OS=Mus musculus OX=10090 GN=Uimc1 PE=1 SV=2
3	AFDB:Q9QWH1	0.068	0.062	4.729E-4	850	0.161	0.136	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
4	AFDB:Q8IXK0	0.069	0.068	1.047E-3	858	0.149	0.125	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
5	AFDB:A0A0A0MSI2	0.084	0.075	1.195E-3	830	0.149	0.129	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
6	AFDB:Q9VF00	0.080	0.078	6.254E-3	746	0.127	0.122	Q9VF00.pdb.gz	Q9VF00_DROME GATAe, isoform A OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=2
7	AFDB:Q14781	0.061	0.077	2.868E-2	532	0.083	0.113	Q14781.pdb.gz	CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2
8	AFDB:Q766Z3	0.049	0.025	3.737E-2	1890	0.136	0.052	Q766Z3.pdb.gz	REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=REV3 PE=2 SV=1
9	AFDB:Q8T9B8	0.063	0.054	3.993E-2	874	0.142	0.117	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
10	AFDB:Q3TXU6	0.075	0.069	7.741E-2	800	0.136	0.122	Q3TXU6.pdb.gz	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
11	PDB:3mhhC	0.045	0.311	5.043	93	0.010	0.075	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:6fszKK	0.043	0.067	5.043	414	0.014	0.024	6fszKK.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
13	PDB:6lqsr6	0.043	0.191	5.043	104	0.014	0.096	6lqsr6.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:5datSM	0.040	0.108	6.572	159	0.032	0.145	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
15	PDB:7bw1A	0.022	0.059	6.572	245	0.007	0.020	7bw1A.pdb.gz	Structure of human steroid 5 alpha-reductase 2 with anti-androgen drug finasteride.
16	PDB:7oniR	0.043	0.224	6.572	86	0.015	0.128	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:6hhqb	0.027	0.177	7.022	97	0.006	0.041	6hhqb.pdb.gz	Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
18	PDB:7uhyA	0.043	0.042	7.022	771	0.028	0.026	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:5c0xK	0.041	0.076	8.564	350	0.013	0.026	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
20	PDB:5iy7M	0.036	0.070	8.564	310	0.019	0.045	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U5Q9	0.0	1085	727	0.766	0.758	UIMC1_MOUSE BRCA1-A complex subunit RAP80 OS=Mus musculus OX=10090 GN=Uimc1 PE=1 SV=2
2	Q96RL1	0.0	1473	719	1.000	1.000	UIMC1_HUMAN BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1 PE=1 SV=2
3	Q5B224	0.91	35.4	1709	0.057	0.024	Q5B224_EMENI DNA topoisomerase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05406 PE=3 SV=1
4	Q9VPR5	1.2	35.0	1340	0.029	0.016	Q9VPR5_DROME Splicing factor 3b subunit 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sf3b1 PE=1 SV=2
5	Q3EBM5	2.4	33.9	447	0.033	0.054	ASPR1_ARATH Probable aspartic protease At2g35615 OS=Arabidopsis thaliana OX=3702 GN=At2g35615 PE=3 SV=1
6	Q9C864	2.6	33.5	445	0.036	0.058	Q9C864_ARATH Aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=At1g31450 PE=1 SV=1
7	O94919	2.7	33.5	500	0.024	0.034	ENDD1_HUMAN Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2
8	Q383X8	7.4	32.3	516	0.025	0.035	Q383X8_TRYB2 Nucleic acid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1270 PE=4 SV=1
9	Q91XU0	8.0	32.3	660	0.026	0.029	WRIP1_MOUSE ATPase WRNIP1 OS=Mus musculus OX=10090 GN=Wrnip1 PE=1 SV=2
10	Q96S55	8.3	32.3	665	0.026	0.029	WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18282 RAP80_UIM	4.2e-30	114.6	RAP80 N-terminal ubiquitin interaction motif
2	PF02809 UIM	20	16.4	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352408	0.999	BRISC and BRCA1-A complex member 1
2	9606.ENSP00000358474	0.999	Lys-63-specific deubiquitinase BRCC36
3	9606.ENSP00000369857	0.999	BRCA1-A complex subunit Abraxas 1
4	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000260947	0.998	BRCA1-associated RING domain protein 1
6	9606.ENSP00000343412	0.998	BRISC and BRCA1-A complex member 2
7	9606.ENSP00000405965	0.998	Small ubiquitin-related modifier 2
8	9606.ENSP00000441543	0.998	Polyubiquitin-C
9	9606.ENSP00000365588	0.997	Mediator of DNA damage checkpoint protein 1
10	9606.ENSP00000362578	0.991	E3 ubiquitin-protein ligase RNF8
11	9606.ENSP00000371475	0.991	TP53-binding protein 1
12	9606.ENSP00000272317	0.988	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000434024	0.987	Histone H2AX
14	9606.ENSP00000304697	0.985	Polyubiquitin-B
15	9606.ENSP00000388107	0.979	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000348056	0.974	SUMO-conjugating enzyme UBC9
17	9606.ENSP00000278616	0.966	Serine-protein kinase ATM
18	9606.ENSP00000426503	0.965	E3 ubiquitin-protein ligase RNF4
19	9606.ENSP00000320898	0.958	E3 ubiquitin-protein ligase RNF168
20	9606.ENSP00000265433	0.946	Nibrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0070530	0.999	K63-linked polyubiquitin modification-dependent protein binding
GO:0046965	0.988	nuclear retinoid X receptor binding
GO:0003824	0.628	catalytic activity
GO:1901363	0.308	heterocyclic compound binding
GO:0097159	0.308	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006974	0.996	cellular response to DNA damage stimulus
GO:0006259	0.996	DNA metabolic process
GO:0006281	0.994	DNA repair
GO:0019538	0.988	protein metabolic process
GO:0048523	0.987	negative regulation of cellular process
GO:0051054	0.985	positive regulation of DNA metabolic process
GO:0006508	0.981	proteolysis
GO:0070647	0.979	protein modification by small protein conjugation or removal
GO:0006302	0.976	double-strand break repair
GO:0044773	0.975	mitotic DNA damage checkpoint signaling
GO:1901990	0.973	regulation of mitotic cell cycle phase transition
GO:0045934	0.971	negative regulation of nucleobase-containing compound metabolic process
GO:0048584	0.969	positive regulation of response to stimulus
GO:0006282	0.969	regulation of DNA repair
GO:0009889	0.966	regulation of biosynthetic process
GO:0010212	0.957	response to ionizing radiation
GO:1901991	0.947	negative regulation of mitotic cell cycle phase transition
GO:0016570	0.946	histone modification
GO:2001022	0.944	positive regulation of response to DNA damage stimulus
GO:0010389	0.937	regulation of G2/M transition of mitotic cell cycle
GO:0010556	0.930	regulation of macromolecule biosynthetic process
GO:0044818	0.926	mitotic G2/M transition checkpoint
GO:0031326	0.924	regulation of cellular biosynthetic process
GO:0045739	0.923	positive regulation of DNA repair
GO:0070646	0.922	protein modification by small protein removal
GO:0007095	0.919	mitotic G2 DNA damage checkpoint signaling
GO:0016579	0.913	protein deubiquitination
GO:0010468	0.900	regulation of gene expression
GO:0016578	0.847	histone deubiquitination
GO:0010605	0.791	negative regulation of macromolecule metabolic process
GO:0006355	0.778	regulation of DNA-templated transcription
GO:0045892	0.612	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	1.000	nuclear body
GO:0032991	0.989	protein-containing complex
GO:0140513	0.936	nuclear protein-containing complex
GO:0005829	0.573	cytosol
GO:0043232	0.526	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]