StarFunc result for job id Q96RL6

User Input

>input (698 residues)
MVPGQAQPQSPEMLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPR
DGWDESTAAYGYWFKGRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCSLVIRD
AQREDEAWYFFRVERGSRVRHSFLSNAFFLKVTALTKKPDVYIPETLEPGQPVTVICVFN
WAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRKGVSAQ
RTVRLRVAYAPKDLIISISHDNTSALELQGNVIYLEVQKGQFLRLLCAADSQPPATLSWV
LQDRVLSSSHPWGPRTLGLELRGVRAGDSGRYTCRAENRLGSQQQALDLSVQYPPENLRV
MVSQANRTVLENLGNGTSLPVLEGQSLRLVCVTHSSPPARLSWTRWGQTVGPSQPSDPGV
LELPPIQMEHEGEFTCHAQHPLGSQHVSLSLSVHYPPQLLGPSCSWEAEGLHCSCSSQAS
PAPSLRWWLGEELLEGNSSQGSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCKAWNVHGA
QSGSVFQLLPGKLEHGGGLGLGAALGAGVAALLAFCSCLVVFRVKICRKEARKRAAAEQD
VPSTLGPISQGHQHECSAGSSQDHPPPGAATYTPGKGEEQELHYASLSFQGLRLWEPADQ
EAPSTTEYSEIKIHTGQPLRGPGFGLQLEREMSGMVPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RL6	1.000	1.000	0.000	698	1.000	1.000	Q96RL6.pdb.gz	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
2	AFDB:Q80ZE3	0.724	0.734	7.701E-70	688	0.536	0.544	Q80ZE3.pdb.gz	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
3	AFDB:A6NMB1	0.475	0.650	3.933E-66	481	0.605	0.877	A6NMB1.pdb.gz	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
4	AFDB:O15389	0.285	0.355	2.408E-47	551	0.405	0.514	O15389.pdb.gz	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
5	AFDB:Q920G3	0.296	0.359	2.670E-46	569	0.355	0.436	Q920G3.pdb.gz	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
6	AFDB:F1QSA4	0.404	0.426	3.060E-36	653	0.215	0.230	F1QSA4.pdb.gz	F1QSA4_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
7	AFDB:Q9NYZ4	0.300	0.412	8.639E-36	499	0.321	0.449	Q9NYZ4.pdb.gz	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
8	AFDB:Q96PQ1	0.250	0.287	6.885E-35	595	0.305	0.358	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
9	AFDB:Q9Y286	0.303	0.442	3.762E-34	467	0.295	0.441	Q9Y286.pdb.gz	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
10	AFDB:Q91Y57	0.295	0.429	9.838E-32	467	0.271	0.405	Q91Y57.pdb.gz	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
11	PDB:5oj2B	0.220	0.222	1.709E-15	692	0.148	0.149	5oj2B.pdb.gz
12	PDB:1e07A	0.214	0.228	9.789E-15	642	0.135	0.146	1e07A.pdb.gz
13	PDB:6dldD	0.203	0.441	1.005E-11	269	0.076	0.197	6dldD.pdb.gz
14	PDB:2rcjC	0.172	0.213	7.292E-11	523	0.133	0.178	2rcjC.pdb.gz
15	PDB:6dlfA	0.211	0.489	2.262E-10	236	0.077	0.229	6dlfA.pdb.gz
16	PDB:7sqcO0	0.187	0.134	3.801E-10	1140	0.100	0.061	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6h03A	0.180	0.117	1.890E-9	1223	0.079	0.045	6h03A.pdb.gz
18	PDB:4rtdA	0.128	0.091	2.177E-9	1122	0.083	0.052	4rtdA.pdb.gz
19	PDB:4lnvA	0.134	0.087	5.593E-9	1276	0.096	0.053	4lnvA.pdb.gz
20	PDB:7q5zA	0.151	0.091	8.965E-9	1344	0.103	0.054	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMB1	0.0	825	481	0.589	0.854	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
2	Q80ZE3	0.0	687	688	0.540	0.548	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
3	Q96LC7	0.0	935	697	0.688	0.689	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
4	Q96RL6	0.0	1422	698	1.000	1.000	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
5	O15389	1.98e-98	315	551	0.309	0.392	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
6	Q08ET2	1.95e-80	263	396	0.215	0.379	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
7	Q9Y286	2.48e-78	260	467	0.206	0.308	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
8	Q920G3	5.23e-75	254	569	0.258	0.316	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
9	Q9NYZ4	1.37e-74	251	499	0.221	0.309	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
10	Q91Y57	2.10e-72	244	467	0.196	0.293	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
11	Q9Y336	3.18e-72	243	463	0.199	0.300	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
12	O43699	6.17e-69	234	453	0.199	0.307	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2
13	Q96PQ1	3.08e-68	236	595	0.196	0.230	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
14	P20138	8.63e-59	204	364	0.155	0.297	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
15	Q546G0	8.63e-59	204	364	0.155	0.297	Q546G0_HUMAN CD33 antigen (Gp67) OS=Homo sapiens OX=9606 GN=CD33 PE=4 SV=1
16	A0A0R4IQ16	1.56e-51	191	635	0.232	0.255	A0A0R4IQ16_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
17	F1QSA4	1.41e-49	186	653	0.236	0.253	F1QSA4_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
18	G3X9N0	1.15e-44	164	293	0.138	0.328	G3X9N0_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=4 SV=1
19	Q3Y597	3.03e-44	163	309	0.138	0.311	Q3Y597_MOUSE SIGLEC-H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
20	Q4QQK7	3.74e-44	162	309	0.138	0.311	Q4QQK7_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	8.5e-06	37.1	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	1.7e-18	77.8	Immunoglobulin I-set domain
3	PF00047 ig	2.7e-15	67.6	Immunoglobulin domain
4	PF13895 Ig_2	1.3e-21	88.0	Immunoglobulin domain
5	PF13927 Ig_3	1.4e-23	94.6	Immunoglobulin domain
6	PF17736 Ig_C17orf99	1.9e+02	13.5	C17orf99 Ig domain
7	PF07686 V-set	5.9e-16	70.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.844	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000262629	0.640	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000374125	0.580	Sialic acid-binding Ig-like lectin 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.882	enzyme binding
GO:0043167	0.469	ion binding
GO:0033691	0.380	sialic acid binding
GO:0019902	0.370	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048583	0.994	regulation of response to stimulus
GO:0080134	0.979	regulation of response to stress
GO:0031347	0.971	regulation of defense response
GO:0032101	0.970	regulation of response to external stimulus
GO:0009987	0.914	cellular process
GO:0050794	0.876	regulation of cellular process
GO:0048519	0.868	negative regulation of biological process
GO:0048518	0.856	positive regulation of biological process
GO:0048584	0.806	positive regulation of response to stimulus
GO:0051239	0.766	regulation of multicellular organismal process
GO:0002682	0.710	regulation of immune system process
GO:0050896	0.705	response to stimulus
GO:0019222	0.626	regulation of metabolic process
GO:0060255	0.615	regulation of macromolecule metabolic process
GO:0002831	0.605	regulation of response to biotic stimulus
GO:0010646	0.580	regulation of cell communication
GO:0023051	0.577	regulation of signaling
GO:0023052	0.564	signaling
GO:0050727	0.561	regulation of inflammatory response
GO:0009966	0.561	regulation of signal transduction
GO:0048522	0.550	positive regulation of cellular process
GO:0051716	0.527	cellular response to stimulus
GO:0051240	0.501	positive regulation of multicellular organismal process
GO:0010604	0.477	positive regulation of macromolecule metabolic process
GO:0032502	0.472	developmental process
GO:0001817	0.469	regulation of cytokine production
GO:0032501	0.466	multicellular organismal process
GO:0048585	0.463	negative regulation of response to stimulus
GO:0050776	0.442	regulation of immune response
GO:0002833	0.440	positive regulation of response to biotic stimulus
GO:0007154	0.439	cell communication
GO:0031349	0.439	positive regulation of defense response
GO:0032103	0.423	positive regulation of response to external stimulus
GO:0048856	0.415	anatomical structure development
GO:0010628	0.386	positive regulation of gene expression
GO:0042221	0.332	response to chemical
GO:0007165	0.331	signal transduction
GO:0048523	0.329	negative regulation of cellular process
GO:0002684	0.329	positive regulation of immune system process
GO:0051128	0.313	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.948	intracellular anatomical structure
GO:0043226	0.937	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0043229	0.908	intracellular organelle
GO:0043231	0.883	intracellular membrane-bounded organelle
GO:0012505	0.642	endomembrane system
GO:0031982	0.578	vesicle
GO:0097708	0.515	intracellular vesicle
GO:0031410	0.512	cytoplasmic vesicle
GO:0030659	0.479	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]