StarFunc result for job id Q96RN1

User Input

>input (970 residues)
MAQLERSAISGFSSKSRRNSFAYDVKREVYNEETFQQEHKRKASSSGNMNINITTFRHHV
QCRCSWHRFLRCVLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKVSPFNNGQLVMGSFVKN
EFSAPSYLMGYNKSLSVVATTTFLTGIIQLIMGVLGLGFIATYLPESAMSAYLAAVALHI
MLSQLTFIFGIMISFHAGPISFFYDIINYCVALPKANSTSILVFLTVVVALRINKCIRIS
FNQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLLPVTPDFSLLPKIILQ
AFSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAIARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYTLPNAVLAGIILSNVIPYLETISNLPSLW
RQDQYDCALWMMTFSSSIFLGLDIGLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYRS
INDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTN
LQGGKICRCFCNCDDLEPLPRILYTERFENKLDPEASSINLIHCSHFESMNTSQTASEDQ
VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLLPS
VHTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFERNDFFDAGIT
KTQLFLSVHDAVLFALSRKVIGSSELSIDESETVIRETYSETDKNDNSRYKMSSSFLGSQ
KNVSPGFIKIQQPVEEESELDLELESEQEAGLGLDLDLDRELEPEMEPKAETETKTQTEM
EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSY
SPEGNSNEDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RN1	1.000	1.000	0.000	970	1.000	1.000	Q96RN1.pdb.gz	S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens OX=9606 GN=SLC26A8 PE=1 SV=1
2	AFDB:Q9BXS9	0.581	0.730	1.695E-43	759	0.235	0.300	Q9BXS9.pdb.gz	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
3	AFDB:O43511	0.606	0.746	6.214E-43	780	0.214	0.267	O43511.pdb.gz	S26A4_HUMAN Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV=1
4	AFDB:Q9R154	0.585	0.717	1.611E-42	780	0.219	0.272	Q9R154.pdb.gz	S26A4_RAT Pendrin OS=Rattus norvegicus OX=10116 GN=Slc26a4 PE=1 SV=1
5	AFDB:C8XTB7	0.595	0.747	1.835E-42	760	0.228	0.291	C8XTB7.pdb.gz	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
6	AFDB:B6DUH7	0.577	0.738	1.083E-41	745	0.211	0.275	B6DUH7.pdb.gz	B6DUH7_DANRE Chloride anion exchanger OS=Danio rerio OX=7955 GN=si:dkey-31f5.2 PE=2 SV=1
7	PDB:7lguA	0.573	0.797	2.444E-38	680	0.206	0.294	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
8	PDB:7ch1A	0.550	0.807	1.096E-35	640	0.196	0.297	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
9	AFDB:F1RCN8	0.554	0.809	3.770E-34	647	0.188	0.281	F1RCN8.pdb.gz
10	AFDB:G5EEA7	0.559	0.708	7.218E-34	749	0.184	0.238	G5EEA7.pdb.gz	G5EEA7_CAEEL Anion transporter SULP-4 OS=Caenorhabditis elegans OX=6239 GN=sulp-4 PE=1 SV=1
11	AFDB:G5EDS5	0.545	0.788	7.755E-32	652	0.169	0.252	G5EDS5.pdb.gz	G5EDS5_CAEEL Anion transporter SULP-2 OS=Caenorhabditis elegans OX=6239 GN=sulp-2 PE=2 SV=1
12	AFDB:Q12325	0.494	0.533	3.352E-24	893	0.134	0.146	Q12325.pdb.gz	SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUL2 PE=1 SV=1
13	PDB:8cs9g	0.322	0.369	1.621E-6	832	0.058	0.067	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:4yzfA	0.305	0.560	1.846E-6	475	0.061	0.124	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:3qe7A	0.301	0.655	6.481E-6	407	0.060	0.143	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
16	PDB:7tvzA	0.322	0.362	1.541E-5	850	0.068	0.078	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
17	PDB:5i6cA	0.315	0.582	2.179E-5	480	0.057	0.115	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
18	PDB:6caaA	0.281	0.516	5.410E-5	477	0.075	0.153	6caaA.pdb.gz
19	PDB:5j4nA	0.093	0.153	2.427E-2	437	0.056	0.124	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:4f35B	0.058	0.108	3.583E-2	414	0.057	0.133	4f35B.pdb.gz	Structure and mechanism of a bacterial sodium-dependent dicarboxylate transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RN1	0.0	2001	970	1.000	1.000	S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens OX=9606 GN=SLC26A8 PE=1 SV=1
2	Q8CIW6	8.96e-106	348	758	0.239	0.306	S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus OX=10090 GN=Slc26a6 PE=1 SV=2
3	Q9BXS9	5.98e-105	346	759	0.239	0.306	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
4	D3Z9I5	7.34e-102	337	758	0.239	0.306	D3Z9I5_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
5	A9JTH4	4.13e-100	334	808	0.228	0.274	A9JTH4_DANRE Solute carrier family 26 member 6, like OS=Danio rerio OX=7955 GN=SLC26A6 PE=2 SV=1
6	A0A8I6AS58	1.53e-99	330	704	0.236	0.325	A0A8I6AS58_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
7	B6DUH7	8.63e-98	326	745	0.242	0.315	B6DUH7_DANRE Chloride anion exchanger OS=Danio rerio OX=7955 GN=si:dkey-31f5.2 PE=2 SV=1
8	Q9EPH0	1.35e-97	325	744	0.223	0.290	S26A5_RAT Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1
9	C8XTB7	5.09e-97	324	760	0.228	0.291	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
10	A9C3T3	6.23e-95	318	747	0.187	0.242	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
11	P40879	4.75e-94	317	764	0.201	0.255	S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens OX=9606 GN=SLC26A3 PE=1 SV=1
12	A0A0A7HG43	4.79e-94	317	783	0.228	0.282	A0A0A7HG43_ONCMY Slc26a6 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	Q7T2C4	7.76e-89	301	739	0.190	0.249	S26A5_DANRE Prestin OS=Danio rerio OX=7955 GN=slc26a5 PE=2 SV=1
14	Q7LBE3	5.11e-87	298	791	0.252	0.308	S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens OX=9606 GN=SLC26A9 PE=1 SV=1
15	Q8BU91	1.32e-86	297	790	0.240	0.295	S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus OX=10090 GN=Slc26a9 PE=1 SV=1
16	Q99NH7	4.40e-85	291	744	0.216	0.282	S26A5_MOUSE Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=1 SV=3
17	O43511	6.12e-84	289	780	0.222	0.276	S26A4_HUMAN Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV=1
18	P58743	2.06e-82	284	744	0.163	0.212	S26A5_HUMAN Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1
19	Q924C9	4.08e-79	275	757	0.190	0.243	S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus OX=10116 GN=Slc26a3 PE=2 SV=1
20	Q9WVC8	2.95e-77	270	757	0.184	0.235	S26A3_MOUSE Chloride anion exchanger OS=Mus musculus OX=10090 GN=Slc26a3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06390 NESP55	1.3	20.1	Neuroendocrine-specific golgi protein P55 (NESP55)
2	PF01740 STAS	2.9e-14	64.1	STAS domain
3	PF00916 Sulfate_transp	6.6e-70	247.4	Sulfate permease family
4	PF05887 Trypan_PARP	9.6	17.6	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000003084	0.897	Cystic fibrosis transmembrane conductance regulator
2	9606.ENSP00000404190	0.880	Rac GTPase-activating protein 1
3	9606.ENSP00000265748	0.768	Anillin
4	9606.ENSP00000362931	0.763	SRSF protein kinase 1
5	9606.ENSP00000288065	0.734	Armadillo repeat containing 12
6	9606.ENSP00000362282	0.728	Molybdenum cofactor biosynthesis protein 1
7	9606.ENSP00000376457	0.721	Protein ECT2
8	9606.ENSP00000363135	0.675	Uncharacterized protein C6orf106
9	9606.ENSP00000383820	0.649	Mesoderm induction early response protein 1
10	9606.ENSP00000317902	0.629	Centrosomal protein of 57 kDa
11	9606.ENSP00000355279	0.612	CCR4-NOT transcription complex subunit 7
12	9606.ENSP00000353458	0.610	Bromodomain adjacent to zinc finger domain protein 1A
13	9606.ENSP00000260363	0.608	Kinesin-like protein KIF23
14	9606.ENSP00000215659	0.578	Mitogen-activated protein kinase 12
15	9606.ENSP00000299601	0.565	RNA polymerase-associated protein LEO1
16	9606.ENSP00000412940	0.527	FRAS1-related extracellular matrix protein 1
17	9606.ENSP00000378957	0.526	Microfibril-associated glycoprotein 4
18	9606.ENSP00000228841	0.522	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
19	9606.ENSP00000386126	0.519	Uromodulin like 1
20	9606.ENSP00000344431	0.515	DnaJ homolog subfamily B member 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015116	1.000	sulfate transmembrane transporter activity
GO:0005254	1.000	chloride channel activity
GO:0005310	0.999	dicarboxylic acid transmembrane transporter activity
GO:0019531	0.807	oxalate transmembrane transporter activity
GO:0022804	0.412	active transmembrane transporter activity
GO:0015291	0.398	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.982	localization
GO:0006820	0.941	monoatomic anion transport
GO:0015698	0.937	inorganic anion transport
GO:0072348	0.936	sulfur compound transport
GO:0046942	0.896	carboxylic acid transport
GO:0006835	0.877	dicarboxylic acid transport
GO:0006821	0.800	chloride transport
GO:0071705	0.640	nitrogen compound transport
GO:0009987	0.609	cellular process
GO:0065007	0.479	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.802	membrane-bounded organelle
GO:0005622	0.791	intracellular anatomical structure
GO:0043231	0.654	intracellular membrane-bounded organelle
GO:0005737	0.594	cytoplasm
GO:0005634	0.508	nucleus
GO:0005829	0.424	cytosol
GO:0012505	0.331	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34983	1.000	sulfate(in) = sulfate(out)
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]