StarFunc result for job id Q96RP3

User Input

>input (112 residues)
MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RP3	1.000	1.000	4.850E-14	112	1.000	1.000	Q96RP3.pdb.gz	UCN2_HUMAN Urocortin-2 OS=Homo sapiens OX=9606 GN=UCN2 PE=1 SV=1
2	AFDB:Q99ML8	0.334	0.331	4.308E-6	113	0.589	0.584	Q99ML8.pdb.gz	UCN2_MOUSE Urocortin-2 OS=Mus musculus OX=10090 GN=Ucn2 PE=1 SV=2
3	PDB:6n7pA	0.168	0.106	4.114	186	0.125	0.075	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
4	AFDB:Q98TA4	0.259	0.122	4.663	254	0.188	0.083	Q98TA4.pdb.gz	MBL_CHICK Mannose-binding protein OS=Gallus gallus OX=9031 GN=MBL PE=2 SV=2
5	PDB:7d4iRJ	0.304	0.048	5.147	738	0.107	0.016	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
6	AFDB:B9ZSH6	0.226	0.081	6.287	358	0.152	0.047	B9ZSH6.pdb.gz	B9ZSH6_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0101000 PE=4 SV=1
7	AFDB:Q54TZ2	0.311	0.093	6.287	386	0.143	0.041	Q54TZ2.pdb.gz	Q54TZ2_DICDI SNARE-complex protein Syntaxin-18 N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281429 PE=3 SV=1
8	AFDB:Q5VTL8	0.291	0.067	6.287	546	0.125	0.026	Q5VTL8.pdb.gz	PR38B_HUMAN Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1
9	AFDB:Q9NX45	0.199	0.074	6.775	425	0.170	0.045	Q9NX45.pdb.gz	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
10	AFDB:P14907	0.303	0.048	7.300	823	0.116	0.016	P14907.pdb.gz	NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSP1 PE=1 SV=1
11	AFDB:D4A7M5	0.310	0.111	8.476	330	0.125	0.042	D4A7M5.pdb.gz	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
12	AFDB:Q94AX2	0.271	0.120	8.476	277	0.143	0.058	Q94AX2.pdb.gz	PTST_ARATH Protein PTST, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTST PE=1 SV=1
13	PDB:6i9r6	0.194	0.067	9.357	354	0.143	0.045	6i9r6.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RP3	1.39e-75	220	112	1.000	1.000	UCN2_HUMAN Urocortin-2 OS=Homo sapiens OX=9606 GN=UCN2 PE=1 SV=1
2	Q91WW1	1.44e-32	112	109	0.616	0.633	UCN2_RAT Urocortin-2 OS=Rattus norvegicus OX=10116 GN=Ucn2 PE=3 SV=1
3	Q99ML8	5.83e-31	107	113	0.598	0.593	UCN2_MOUSE Urocortin-2 OS=Mus musculus OX=10090 GN=Ucn2 PE=1 SV=2
4	Q924A4	3.79e-05	42.7	164	0.152	0.104	UCN3_MOUSE Urocortin-3 OS=Mus musculus OX=10090 GN=Ucn3 PE=2 SV=1
5	A1YKY5	1.11e-04	41.2	164	0.143	0.098	A1YKY5_RAT Urocortin 3 OS=Rattus norvegicus OX=10116 GN=Ucn3 PE=3 SV=1
6	Q969E3	3.35e-04	40.0	161	0.143	0.099	UCN3_HUMAN Urocortin-3 OS=Homo sapiens OX=9606 GN=UCN3 PE=1 SV=2
7	Q54VJ6	0.045	34.7	462	0.125	0.030	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
8	W5U9F7	0.11	32.7	135	0.134	0.111	W5U9F7_ICTPU UI OS=Ictalurus punctatus OX=7998 GN=UTS1 PE=2 SV=1
9	F4K4L3	0.18	32.7	631	0.125	0.022	F4K4L3_ARATH Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=MMG4.12 PE=1 SV=1
10	Q96FA6	0.33	32.0	558	0.196	0.039	Q96FA6_HUMAN NCAPD3 protein (Fragment) OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
11	P34109	0.38	32.0	1109	0.241	0.024	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
12	P55089	0.42	31.2	124	0.152	0.137	UCN1_HUMAN Urocortin OS=Homo sapiens OX=9606 GN=UCN PE=1 SV=1
13	Q703P0	0.43	31.2	167	0.250	0.168	Q703P0_CHICK Corticotropin releasing hormone OS=Gallus gallus OX=9031 GN=CRH PE=2 SV=1
14	P81615	0.44	30.8	122	0.152	0.139	UCN1_MOUSE Urocortin OS=Mus musculus OX=10090 GN=Ucn PE=1 SV=1
15	P55090	0.48	30.8	122	0.152	0.139	UCN1_RAT Urocortin OS=Rattus norvegicus OX=10116 GN=Ucn PE=1 SV=1
16	P49188	0.83	30.4	162	0.152	0.105	CRF_XENLA Corticoliberin OS=Xenopus laevis OX=8355 GN=crh PE=3 SV=1
17	Q9DDT5	1.6	30.0	1084	0.179	0.018	SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio OX=7955 GN=supt5h PE=1 SV=1
18	Q4G061	1.7	30.0	797	0.116	0.016	EIF3B_RAT Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus OX=10116 GN=Eif3b PE=1 SV=1
19	Q9BX69	2.0	29.6	1037	0.170	0.018	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
20	E9QGD4	2.5	29.6	870	0.134	0.017	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00473 CRF	4.8e-10	50.6	Corticotropin-releasing factor family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273610

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340943	0.998	Corticotropin-releasing factor receptor 2
2	9606.ENSP00000381333	0.989	Corticotropin-releasing factor receptor 1
3	9606.ENSP00000276571	0.984	Corticoliberin
4	9606.ENSP00000369798	0.981	Urocortin-3
5	9606.ENSP00000296099	0.974	Urocortin
6	9606.ENSP00000274368	0.893	Corticotropin-releasing factor-binding protein
7	9606.ENSP00000384092	0.603	Pro-opiomelanocortin
8	9606.ENSP00000341483	0.602	Ran-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042562	1.000	hormone binding
GO:0071855	1.000	neuropeptide receptor binding
GO:0051428	1.000	peptide hormone receptor binding
GO:0051429	0.962	corticotropin-releasing hormone receptor binding
GO:0140677	0.438	molecular function activator activity
GO:0048018	0.417	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0032870	0.986	cellular response to hormone stimulus
GO:0007188	0.980	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0009755	0.701	hormone-mediated signaling pathway
GO:0007189	0.665	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0032879	0.339	regulation of localization
GO:0032501	0.332	multicellular organismal process
GO:0051239	0.328	regulation of multicellular organismal process
GO:0023051	0.302	regulation of signaling
GO:0010646	0.302	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]