StarFunc result for job id Q96RP9

User Input

>input (751 residues)
MRLLGAAAVAALGRGRAPASLGWQRKQVNWKACRWSSSGVIPNEKIRNIGISAHIDSGKT
TLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNINIID
TPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMG
SNPARALQQMRSKLNHNAAFMQIPMGLEGNFKGIVDLIEERAIYFDGDFGQIVRYGEIPA
ELRAAATDHRQELIECVANSDEQLGEMFLEEKIPSISDLKLAIRRATLKRSFTPVFLGSA
LKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDDSKEKTKILMNSSRDNSHPFVGLAFKL
EVGRFGQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICAL
FGIDCASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTF
KVYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKPKVAFRETITAPVPFDFTHK
KQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLS
GHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEF
QGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRY
QPCLPSTQEDVINKYLEATGQLPVKKGKAKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6vlzv	0.904	0.952	0.000	712	0.948	1.000	6vlzv.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
2	AFDB:E1BEJ3	0.959	0.957	0.000	753	0.924	0.922	E1BEJ3.pdb.gz	E1BEJ3_BOVIN Elongation factor G, mitochondrial OS=Bos taurus OX=9913 GN=GFM1 PE=3 SV=2
3	AFDB:F4IW10	0.911	0.907	0.000	754	0.522	0.520	F4IW10.pdb.gz	EFGM2_ARATH Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG2 PE=1 SV=1
4	AFDB:P25039	0.639	0.631	0.000	761	0.531	0.524	P25039.pdb.gz	EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF1 PE=1 SV=2
5	AFDB:Q9VM33	0.936	0.944	0.000	745	0.640	0.646	Q9VM33.pdb.gz	EFGM_DROME Elongation factor G, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFG1 PE=2 SV=2
6	AFDB:Q9USZ1	0.641	0.626	4.449E-103	770	0.521	0.508	Q9USZ1.pdb.gz	EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef1 PE=3 SV=2
7	AFDB:O30913	0.647	0.698	6.909E-103	693	0.474	0.514	O30913.pdb.gz	EFG1_BORBU Elongation factor G 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=fusA PE=3 SV=2
8	AFDB:Q38BA0	0.881	0.887	5.583E-95	746	0.414	0.417	Q38BA0.pdb.gz	Q38BA0_TRYB2 Elongation factor G, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2190 PE=3 SV=1
9	AFDB:P13551	0.884	0.960	7.766E-95	691	0.413	0.449	P13551.pdb.gz	EFG_THETH Elongation factor G OS=Thermus thermophilus OX=274 GN=fusA PE=1 SV=1
10	AFDB:Q8I592	0.893	0.836	1.080E-94	803	0.421	0.394	Q8I592.pdb.gz	Q8I592_PLAF7 Elongation factor G, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1233000 PE=3 SV=1
11	AFDB:Q2G0N1	0.895	0.968	3.144E-91	693	0.385	0.417	Q2G0N1.pdb.gz	EFG_STAA8 Elongation factor G OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fusA PE=1 SV=3
12	PDB:7cdwA	0.562	0.604	5.276E-80	683	0.402	0.442	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.
13	PDB:7pjvx	0.856	0.911	1.524E-77	703	0.406	0.434	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.
14	PDB:2bv3A	0.630	0.729	6.266E-72	632	0.381	0.453	2bv3A.pdb.gz	Crystal Structure of a Mutant Elongation Factor G Trapped with a GTP Analogue.
15	PDB:7nshBC	0.839	0.897	1.222E-70	700	0.330	0.354	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
16	PDB:1jqmB	0.661	0.711	2.133E-62	691	0.406	0.441	1jqmB.pdb.gz
17	PDB:7dvqC	0.470	0.399	1.307E-40	902	0.212	0.176	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:3jb9B	0.481	0.407	1.818E-40	904	0.205	0.170	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:6d9j9	0.642	0.570	1.065E-38	856	0.225	0.197	6d9j9.pdb.gz	Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
20	PDB:6j6gC	0.442	0.369	4.214E-38	920	0.188	0.153	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1BEJ3	0.0	1451	753	0.925	0.923	E1BEJ3_BOVIN Elongation factor G, mitochondrial OS=Bos taurus OX=9913 GN=GFM1 PE=3 SV=2
2	F4IW10	0.0	804	754	0.517	0.515	EFGM2_ARATH Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG2 PE=1 SV=1
3	O30913	0.0	713	693	0.485	0.525	EFG1_BORBU Elongation factor G 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=fusA PE=3 SV=2
4	P0A6M8	0.0	570	704	0.423	0.452	EFG_ECOLI Elongation factor G OS=Escherichia coli (strain K12) OX=83333 GN=fusA PE=1 SV=2
5	P13551	0.0	576	691	0.414	0.450	EFG_THETH Elongation factor G OS=Thermus thermophilus OX=274 GN=fusA PE=1 SV=1
6	P25039	0.0	811	761	0.530	0.523	EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF1 PE=1 SV=2
7	P28371	0.0	562	695	0.411	0.445	EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=fusA PE=1 SV=2
8	P9WNM7	0.0	561	701	0.422	0.452	EFG_MYCTU Elongation factor G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fusA PE=1 SV=1
9	Q38BA0	0.0	587	746	0.423	0.426	Q38BA0_TRYB2 Elongation factor G, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2190 PE=3 SV=1
10	Q8I592	0.0	599	803	0.419	0.392	Q8I592_PLAF7 Elongation factor G, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1233000 PE=3 SV=1
11	Q8K0D5	0.0	1423	751	0.909	0.909	EFGM_MOUSE Elongation factor G, mitochondrial OS=Mus musculus OX=10090 GN=Gfm1 PE=1 SV=1
12	Q96RP9	0.0	1566	751	1.000	1.000	EFGM_HUMAN Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2
13	Q9C641	0.0	806	754	0.517	0.515	EFGM1_ARATH Elongation factor G-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG1 PE=1 SV=1
14	Q9USZ1	0.0	773	770	0.523	0.510	EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef1 PE=3 SV=2
15	Q9VM33	0.0	1028	745	0.638	0.643	EFGM_DROME Elongation factor G, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFG1 PE=2 SV=2
16	Q9SI75	6.28e-175	523	783	0.395	0.379	EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPEFG PE=1 SV=1
17	Q2G0N1	1.05e-174	519	693	0.389	0.421	EFG_STAA8 Elongation factor G OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fusA PE=1 SV=3
18	Q969S9	3.24e-120	381	779	0.341	0.329	RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=GFM2 PE=1 SV=1
19	Q8R2Q4	2.00e-119	379	779	0.332	0.320	RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Gfm2 PE=1 SV=2
20	O94429	1.49e-87	295	813	0.253	0.234	RRF2M_SCHPO Ribosome-releasing factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04548 AIG1	93	13.8	AIG1 family
2	PF16847 AvrPtoB_bdg	87	15.0	Avirulence AvrPtoB, BAK1-binding domain
3	PF00679 EFG_C	8.5e-21	85.1	Elongation factor G C-terminus
4	PF14492 EFG_III	2e-24	96.8	Elongation Factor G, domain III
5	PF03764 EFG_IV	9.7e-32	120.7	Elongation factor G, domain IV
6	PF00009 GTP_EFTU	6.5e-61	216.8	Elongation factor Tu GTP binding domain
7	PF03144 GTP_EFTU_D2	3.8e-13	60.9	Elongation factor Tu domain 2
8	PF01926 MMR_HSR1	13	17.3	50S ribosome-binding GTPase
9	PF16658 RF3_C	0.0053	28.0	Class II release factor RF3, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245539	0.989	Mitochondrial ribosomal protein S7
2	9606.ENSP00000253099	0.983	Mitochondrial ribosomal protein L4
3	9606.ENSP00000362036	0.982	Mitochondrial ribosomal protein S16
4	9606.ENSP00000272418	0.981	Belongs to the universal ribosomal protein uS5 family.
5	9606.ENSP00000322439	0.981	Elongation factor Tu, mitochondrial
6	9606.ENSP00000333837	0.981	39S ribosomal protein L12, mitochondrial
7	9606.ENSP00000343867	0.978	Ribosome-recycling factor, mitochondrial
8	9606.ENSP00000423399	0.962	Mitochondrial ribosomal protein L36
9	9606.ENSP00000317376	0.960	Mitochondrial ribosomal protein S11
10	9606.ENSP00000264995	0.958	Mitochondrial ribosomal protein L3
11	9606.ENSP00000384952	0.958	Mitochondrial ribosomal protein S12
12	9606.ENSP00000308897	0.956	Mitochondrial ribosomal protein L11
13	9606.ENSP00000373404	0.956	Mitochondrial ribosomal protein L2
14	9606.ENSP00000306548	0.955	Mitochondrial ribosomal protein L13
15	9606.ENSP00000418008	0.954	Mitochondrial ribosomal protein S22
16	9606.ENSP00000288937	0.953	Mitochondrial ribosomal protein L17
17	9606.ENSP00000053468	0.950	Mitochondrial ribosomal protein S10
18	9606.ENSP00000258455	0.949	Mitochondrial ribosomal protein S9
19	9606.ENSP00000258383	0.944	39S ribosomal protein L44, mitochondrial
20	9606.ENSP00000360850	0.944	Mitochondrial ribosomal protein S2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003924	1.000	GTPase activity
GO:0003676	0.995	nucleic acid binding
GO:0045182	0.993	translation regulator activity
GO:0005515	0.992	protein binding
GO:0008135	0.974	translation factor activity, RNA binding
GO:0003723	0.924	RNA binding
GO:0003746	0.814	translation elongation factor activity
GO:0043167	0.618	ion binding
GO:0036094	0.537	small molecule binding
GO:0017076	0.498	purine nucleotide binding
GO:0032555	0.471	purine ribonucleotide binding
GO:0043168	0.470	anion binding
GO:0044877	0.389	protein-containing complex binding
GO:0043021	0.343	ribonucleoprotein complex binding
GO:0032561	0.328	guanyl ribonucleotide binding
GO:0035639	0.319	purine ribonucleoside triphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034641	0.997	cellular nitrogen compound metabolic process
GO:0019538	0.996	protein metabolic process
GO:0140053	0.995	mitochondrial gene expression
GO:0006412	0.988	translation
GO:0032543	0.953	mitochondrial translation
GO:0006414	0.900	translational elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.809	mitochondrial matrix
GO:0005634	0.720	nucleus
GO:0043232	0.421	intracellular non-membrane-bounded organelle
GO:0032991	0.380	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]