StarFunc result for job id Q96RQ3

User Input

>input (725 residues)
MAAASAVSVLLVAAERNRWHRLPSLLLPPRTWVWRQRTMKYTTATGRNITKVLIANRGEI
ACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLSMEKIIQVAKTS
AAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPVVEG
YHGEDQSDQCLKEHARRIGYPVMIKAVRGGGGKGMRIVRSEQEFQEQLESARREAKKSFN
DDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGIKSEVRK
KLGEAAVRAAKAVNYVGAGTVEFIMDSKHNFCFMEMNTRLQVEHPVTEMITGTDLVEWQL
RIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGV
RQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFE
AGNVHTDFIPQHHKQLLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSS
SGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKC
SVNGVASKAKLIILENTIYLFSKEGSIEIDIPVPKYLSSVSSQETQGGPLAPMTGTIEKV
FVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESD
KRESE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z693	0.960	0.960	0.000	725	1.000	1.000	A0A0S2Z693.pdb.gz	A0A0S2Z693_HUMAN Methylcrotonoyl-CoA carboxylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCCC1 PE=2 SV=1
2	AFDB:Q99MR8	0.888	0.898	0.000	717	0.832	0.841	Q99MR8.pdb.gz	MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2
3	AFDB:Q42523	0.860	0.850	3.301E-85	734	0.452	0.447	Q42523.pdb.gz	MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCA PE=1 SV=2
4	AFDB:Q42777	0.847	0.840	7.084E-84	731	0.454	0.450	Q42777.pdb.gz	MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=MCCA PE=1 SV=2
5	AFDB:Q9I299	0.854	0.942	6.691E-82	655	0.421	0.466	Q9I299.pdb.gz	Q9I299_PSEAE Methylcrotonyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuD PE=1 SV=1
6	AFDB:Q9HZV6	0.850	0.929	1.854E-80	661	0.408	0.448	Q9HZV6.pdb.gz	Q9HZV6_PSEAE Geranyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuF PE=4 SV=1
7	AFDB:Q6T5L7	0.864	0.867	3.413E-79	723	0.407	0.408	Q6T5L7.pdb.gz	Q6T5L7_EMEND 3-methylcrotonyl-CoA carboxylase biotin-containig subunit OS=Emericella nidulans OX=162425 GN=mccA PE=4 SV=1
8	AFDB:Q57YQ4	0.834	0.889	8.087E-77	678	0.406	0.434	Q57YQ4.pdb.gz	Q57YQ4_TRYB2 3-methylcrotonyl-CoA carboxylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.840 PE=4 SV=1
9	AFDB:P9WPQ3	0.831	0.917	1.217E-76	654	0.353	0.391	P9WPQ3.pdb.gz	ACCA1_MYCTU Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accA1 PE=1 SV=1
10	AFDB:P0DTA4	0.795	0.789	4.354E-75	730	0.382	0.379	P0DTA4.pdb.gz	PCCA_PIG Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCA PE=1 SV=1
11	PDB:3u9sA	0.678	0.786	2.787E-65	621	0.401	0.469	3u9sA.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
12	PDB:3n6rG	0.615	0.681	9.028E-65	646	0.363	0.407	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
13	PDB:3n6rA	0.601	0.722	3.524E-58	591	0.328	0.403	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
14	PDB:1dv2A	0.593	0.949	3.462E-52	450	0.291	0.469	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
15	PDB:5cslB	0.699	0.258	4.951E-52	2072	0.259	0.091	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
16	PDB:5cslA	0.682	0.256	5.210E-52	2050	0.255	0.090	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
17	PDB:3u9sI	0.634	0.912	2.070E-51	498	0.319	0.464	3u9sI.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
18	PDB:5mlkA	0.592	0.946	3.999E-49	451	0.273	0.439	5mlkA.pdb.gz
19	PDB:1dv1B	0.540	0.900	4.892E-48	428	0.276	0.467	1dv1B.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
20	PDB:5cskB	0.685	0.260	1.000E-47	2017	0.246	0.088	5cskB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z693	0.0	1516	725	1.000	1.000	A0A0S2Z693_HUMAN Methylcrotonoyl-CoA carboxylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCCC1 PE=2 SV=1
2	E9PG35	0.0	1233	598	0.825	1.000	E9PG35_HUMAN Methylcrotonyl-CoA carboxylase subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=1
3	E9PHF7	0.0	1288	616	0.850	1.000	E9PHF7_HUMAN Methylcrotonyl-CoA carboxylase subunit 1 OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=1
4	Q42523	0.0	613	734	0.454	0.448	MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCA PE=1 SV=2
5	Q42777	0.0	595	731	0.466	0.462	MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=MCCA PE=1 SV=2
6	Q57YQ4	0.0	540	678	0.417	0.445	Q57YQ4_TRYB2 3-methylcrotonyl-CoA carboxylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.840 PE=4 SV=1
7	Q5B440	0.0	547	712	0.428	0.435	Q5B440_EMENI 3-methylcrotonyl-CoA carboxylase biotin-containig subunit3-methylcrotonyl-CoA carboxylase biotin-containing subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04690 PE=4 SV=1
8	Q96RQ3	0.0	1516	725	1.000	1.000	MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3
9	Q99MR8	0.0	1248	717	0.830	0.840	MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2
10	Q9HZV6	0.0	540	661	0.404	0.443	Q9HZV6_PSEAE Geranyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuF PE=4 SV=1
11	Q9I299	0.0	573	655	0.426	0.472	Q9I299_PSEAE Methylcrotonyl-CoA carboxylase, alpha-subunit (Biotin-containing) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuD PE=1 SV=1
12	Q6T5L7	3.71e-174	518	723	0.406	0.407	Q6T5L7_EMEND 3-methylcrotonyl-CoA carboxylase biotin-containig subunit OS=Emericella nidulans OX=162425 GN=mccA PE=4 SV=1
13	Q5LUF3	8.02e-165	492	681	0.393	0.419	PCCA_RUEPO Propionyl-CoA carboxylase alpha chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccA PE=1 SV=1
14	Q553S7	8.82e-164	491	714	0.383	0.389	Q553S7_DICDI propionyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=pccA PE=4 SV=1
15	Q19842	1.12e-162	488	724	0.388	0.388	PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pcca-1 PE=1 SV=1
16	P9WPQ3	6.10e-157	471	654	0.359	0.398	ACCA1_MYCTU Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accA1 PE=1 SV=1
17	P0DTA4	2.66e-156	472	730	0.385	0.382	PCCA_PIG Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCA PE=1 SV=1
18	P05165	5.29e-154	466	728	0.383	0.382	PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4
19	Q91ZA3	1.30e-148	452	724	0.381	0.381	PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2
20	P14882	3.10e-147	449	737	0.400	0.393	PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pcca PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13532 2OG-FeII_Oxy_2	3.8e+02	12.6	2OG-Fe(II) oxygenase superfamily
2	PF02222 ATP-grasp	2.5e-08	45.2	ATP-grasp domain
3	PF02655 ATP-grasp_3	0.0017	29.9	ATP-grasp domain
4	PF13535 ATP-grasp_4	3.6	18.6	ATP-grasp domain
5	PF14397 ATPgrasp_ST	0.14	22.9	Sugar-transfer associated ATP-grasp
6	PF02785 Biotin_carb_C	5.6e-33	124.6	Biotin carboxylase C-terminal domain
7	PF00289 Biotin_carb_N	1.8e-44	162.2	Biotin carboxylase, N-terminal domain
8	PF00364 Biotin_lipoyl	5.4e-14	63.1	Biotin-requiring enzyme
9	PF13533 Biotin_lipoyl_2	0.00037	31.5	Biotin-lipoyl like
10	PF02786 CPSase_L_D2	6.3e-74	259.6	Carbamoyl-phosphate synthase L chain, ATP binding domain
11	PF07478 Dala_Dala_lig_C	3.8e-11	54.4	D-ala D-ala ligase C-terminus
12	PF09891 DUF2118	3.6e+02	12.5	Uncharacterized protein conserved in archaea (DUF2118)
13	PF01071 GARS_A	5.4	18.3	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
14	PF13437 HlyD_3	1e+02	15.0	HlyD family secretion protein
15	PF16576 HlyD_D23	13	16.5	Barrel-sandwich domain of CusB or HlyD membrane-fusion
16	PF19331 MCCA_BT	2.4e+02	12.6	Methylcrotonoyl-CoA carboxylase subunit alpha BT domain
17	PF05896 NQRA	1.4e+02	13.4	Na(+)-translocating NADH-quinone reductase subunit A (NQRA)
18	PF00358 PTS_EIIA_1	22	16.2	phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1
19	PF08443 RimK	0.0057	27.8	RimK-like ATP-grasp domain
20	PF13375 RnfC_N	12	17.3	RnfC Barrel sandwich hybrid domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343657	0.999	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
2	9606.ENSP00000382071	0.994	Biotin--protein ligase
3	9606.ENSP00000418397	0.981	Isovaleryl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000419027	0.972	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
5	9606.ENSP00000357535	0.950	Enoyl-CoA hydratase, mitochondrial
6	9606.ENSP00000364883	0.944	Methylglutaconyl-CoA hydratase, mitochondrial
7	9606.ENSP00000370023	0.933	Trifunctional enzyme subunit alpha, mitochondrial
8	9606.ENSP00000231887	0.925	Peroxisomal bifunctional enzyme
9	9606.ENSP00000318351	0.874	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
10	9606.ENSP00000348459	0.871	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
11	9606.ENSP00000253079	0.853	Coiled-coil domain-containing protein 62
12	9606.ENSP00000386227	0.818	Colorectal mutant cancer protein
13	9606.ENSP00000400995	0.804	Biotinidase
14	9606.ENSP00000365462	0.796	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
15	9606.ENSP00000328551	0.793	Ras-related protein Rab-28
16	9606.ENSP00000341483	0.792	Ran-binding protein 3
17	9606.ENSP00000274813	0.790	Methylmalonyl-CoA mutase, mitochondrial
18	9606.ENSP00000296015	0.773	Belongs to the TTC14 family
19	9606.ENSP00000372005	0.768	Mitochondrial import inner membrane translocase subunit TIM14
20	9606.ENSP00000269980	0.748	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016421	1.000	CoA carboxylase activity
GO:0005515	0.998	protein binding
GO:1901363	0.309	heterocyclic compound binding
GO:0097159	0.308	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0046395	0.993	carboxylic acid catabolic process
GO:0006807	0.943	nitrogen compound metabolic process
GO:1901564	0.885	organonitrogen compound metabolic process
GO:0009063	0.842	amino acid catabolic process
GO:0044242	0.839	cellular lipid catabolic process
GO:0006631	0.808	fatty acid metabolic process
GO:0072329	0.652	monocarboxylic acid catabolic process
GO:0009062	0.370	fatty acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.971	intracellular organelle lumen
GO:0005759	0.337	mitochondrial matrix
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.4.-.-	1.000	Forming carbon-carbon bonds.

[back to server]