StarFunc result for job id Q96RR4

User Input

>input (588 residues)
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBQ0	0.672	0.672	5.475E-97	588	1.000	1.000	A0A024RBQ0.pdb.gz
2	AFDB:A0A024RBP8	0.567	0.611	2.364E-86	545	0.923	0.996	A0A024RBP8.pdb.gz
3	AFDB:P97756	0.631	0.731	1.469E-63	505	0.507	0.590	P97756.pdb.gz	KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1
4	AFDB:F1RGR1	0.601	0.662	1.210E-61	532	0.507	0.560	F1RGR1.pdb.gz	F1RGR1_PIG Calcium/calmodulin dependent protein kinase kinase 1 OS=Sus scrofa OX=9823 GN=CAMKK1 PE=4 SV=4
5	AFDB:Q3Y416	0.545	0.591	1.201E-51	541	0.386	0.420	Q3Y416.pdb.gz	KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans OX=6239 GN=ckk-1 PE=1 SV=2
6	AFDB:Q5HZ38	0.466	0.667	2.332E-31	407	0.219	0.317	Q5HZ38.pdb.gz	GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana OX=3702 GN=GRIK2 PE=1 SV=1
7	AFDB:Q5A650	0.455	0.199	7.344E-30	1408	0.291	0.121	Q5A650.pdb.gz	Q5A650_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAK1 PE=4 SV=1
8	AFDB:A1ZBL5	0.438	0.274	8.028E-28	951	0.224	0.139	A1ZBL5.pdb.gz	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
9	AFDB:H2KYA5	0.432	0.151	1.083E-26	1793	0.230	0.075	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
10	AFDB:Q9GN62	0.441	0.420	2.295E-25	617	0.224	0.214	Q9GN62.pdb.gz	PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans OX=6239 GN=par-4 PE=1 SV=2
11	PDB:7myjC	0.431	0.539	7.318E-24	465	0.173	0.219	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:5u6yA	0.413	0.524	5.606E-23	459	0.163	0.209	5u6yA.pdb.gz
13	PDB:4zhxA	0.430	0.609	5.932E-23	409	0.156	0.225	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:6b1uA	0.434	0.572	8.328E-23	442	0.163	0.217	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:5ufuA	0.429	0.670	1.003E-21	369	0.146	0.233	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:4rerA	0.435	0.553	2.214E-21	459	0.167	0.214	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5x3fB	0.398	0.651	3.481E-21	349	0.158	0.266	5x3fB.pdb.gz
18	PDB:4rewA	0.422	0.597	3.683E-21	411	0.150	0.214	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6byrA	0.402	0.574	8.603E-21	405	0.155	0.225	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
20	PDB:2pmnX	0.446	0.751	1.431E-20	340	0.112	0.194	2pmnX.pdb.gz	Structures of P. falciparum protein kinase 7 identify an activation motif and leads for inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RGR1	0.0	548	532	0.491	0.543	F1RGR1_PIG Calcium/calmodulin dependent protein kinase kinase 1 OS=Sus scrofa OX=9823 GN=CAMKK1 PE=4 SV=4
2	O88831	0.0	1021	587	0.925	0.927	KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Camkk2 PE=1 SV=1
3	P97756	0.0	559	505	0.490	0.570	KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1
4	Q8C078	0.0	994	588	0.917	0.917	KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Camkk2 PE=1 SV=2
5	Q8N5S9	0.0	560	505	0.491	0.572	KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2
6	Q8VBY2	0.0	553	505	0.485	0.564	KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Camkk1 PE=1 SV=1
7	Q96RR4	0.0	1205	588	1.000	1.000	KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2 PE=1 SV=2
8	Q3Y416	3.00e-141	422	541	0.352	0.383	KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans OX=6239 GN=ckk-1 PE=1 SV=2
9	F5H4I7	6.56e-80	249	125	0.213	1.000	F5H4I7_HUMAN Calcium/calmodulin dependent protein kinase kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=CAMKK2 PE=1 SV=1
10	C8V9K6	8.14e-74	253	789	0.240	0.179	C8V9K6_EMENI Calcium/calmodulin-dependent protein kinase CMKC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08827 PE=4 SV=1
11	Q54WW7	6.19e-69	238	695	0.213	0.180	Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279405 PE=3 SV=1
12	P50526	1.10e-63	223	652	0.236	0.213	SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssp1 PE=1 SV=1
13	Q5HZ38	3.07e-59	204	407	0.196	0.283	GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana OX=3702 GN=GRIK2 PE=1 SV=1
14	Q57YE4	6.41e-54	187	296	0.187	0.372	Q57YE4_TRYB2 Serine/threonine kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.490 PE=3 SV=1
15	Q93V58	7.33e-54	190	396	0.189	0.280	GRIK1_ARATH Serine/threonine-protein kinase GRIK1 OS=Arabidopsis thaliana OX=3702 GN=GRIK1 PE=1 SV=1
16	O22932	1.41e-52	187	435	0.194	0.262	CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CIPK11 PE=1 SV=1
17	P43637	1.86e-48	179	560	0.206	0.216	TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOS3 PE=1 SV=1
18	Q9UU87	1.70e-47	171	354	0.180	0.299	PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk34 PE=3 SV=2
19	Q38997	2.50e-47	175	512	0.177	0.203	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3
20	B9DFC1	8.86e-47	174	512	0.175	0.201	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.9	17.5	ABC1 atypical kinase-like domain
2	PF01636 APH	2.1e+02	13.2	Phosphotransferase enzyme family
3	PF14531 Kinase-like	0.00068	30.6	Kinase-like
4	PF00069 Pkinase	5.2e-61	217.9	Protein kinase domain
5	PF17667 Pkinase_fungal	0.16	22.4	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	5.8e-30	116.0	Protein tyrosine and serine/threonine kinase
7	PF07387 Seadorna_VP7	7.3e+02	10.6	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312741

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323867	0.978	5'-AMP-activated protein kinase subunit gamma-1
2	9606.ENSP00000229328	0.975	5'-AMP-activated protein kinase subunit beta-1
3	9606.ENSP00000360290	0.975	5'-AMP-activated protein kinase catalytic subunit alpha-2
4	9606.ENSP00000287878	0.974	5'-AMP-activated protein kinase subunit gamma-2
5	9606.ENSP00000254101	0.970	5'-AMP-activated protein kinase subunit beta-2
6	9606.ENSP00000346148	0.970	5'-AMP-activated protein kinase catalytic subunit alpha-1
7	9606.ENSP00000256460	0.962	Calcium/calmodulin-dependent protein kinase type 1
8	9606.ENSP00000397133	0.961	5'-AMP-activated protein kinase subunit gamma-3
9	9606.ENSP00000282356	0.949	Calcium/calmodulin-dependent protein kinase type IV
10	9606.ENSP00000379098	0.910	Calcium/calmodulin-dependent protein kinase type II subunit beta
11	9606.ENSP00000158166	0.909	Calcium/calmodulin-dependent protein kinase kinase 1
12	9606.ENSP00000272298	0.892	Calmodulin 2 (phosphorylase kinase, delta)
13	9606.ENSP00000324856	0.886	Serine/threonine-protein kinase STK11
14	9606.ENSP00000304643	0.827	Calmodulin-like protein 6
15	9606.ENSP00000369689	0.821	Calmodulin-like protein 5
16	9606.ENSP00000315299	0.813	Calmodulin-like protein 3
17	9606.ENSP00000419081	0.813	Calmodulin-like protein 4
18	9606.ENSP00000306330	0.806	14-3-3 protein gamma
19	9606.ENSP00000349467	0.794	Calmodulin-1
20	9606.ENSP00000364893	0.784	Rho guanine nucleotide exchange factor 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0005516	0.990	calmodulin binding
GO:0019899	0.349	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006796	0.991	phosphate-containing compound metabolic process
GO:0051174	0.989	regulation of phosphorus metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0051246	0.986	regulation of protein metabolic process
GO:0019538	0.986	protein metabolic process
GO:0006468	0.981	protein phosphorylation
GO:0009893	0.970	positive regulation of metabolic process
GO:0051338	0.964	regulation of transferase activity
GO:0048522	0.957	positive regulation of cellular process
GO:0031399	0.955	regulation of protein modification process
GO:0010562	0.937	positive regulation of phosphorus metabolic process
GO:0051173	0.924	positive regulation of nitrogen compound metabolic process
GO:0050896	0.922	response to stimulus
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0042325	0.873	regulation of phosphorylation
GO:0045937	0.872	positive regulation of phosphate metabolic process
GO:0045859	0.858	regulation of protein kinase activity
GO:0042327	0.830	positive regulation of phosphorylation
GO:0001934	0.822	positive regulation of protein phosphorylation
GO:0051347	0.816	positive regulation of transferase activity
GO:0051716	0.625	cellular response to stimulus
GO:0007154	0.569	cell communication
GO:0023052	0.553	signaling
GO:0007165	0.500	signal transduction
GO:0033674	0.341	positive regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]