StarFunc result for job id Q96RT7

User Input

>input (1819 residues)
MASITQLFDDLCEALLPAAKTHLGQRSVNRKRAKRSLKKVAYNALFTNLFQDETQQLQPD
MSKLPARNKILMLSFDLRVGGLGPKADRLEELVEELEAAPCCPLLEVGSVLDLLVQLAGS
GPPQVLPRKRDYFLNNKHVGRNVPYSGYDCDDLSVFEMDVQSLISREECLCHSMIQETLQ
VMEAAPGTGLPTVGLFSFGDPCGDRFERDTRVSLFGALVHSRTYDMDVRLGLPPVPDNAD
LSGLAIKVPPSVDQWEDEGFQSASNLTPDSQSEPSVTPDVDLWEAALTYEASKRRCWERV
GCPPGHREEPYLTEAGRDAFDKFCRLHQGELQLLAGGVLQAPQPVLVKECELVKDVLNVL
IGVVSATFSLCQPAQAFVVKRGVHVSGASPESISSLLSEVAEYGTCYTRLSHFSLQPVLD
SLYSKGLVFQAFTSGLRRYLQYYRACVLSTPPTLSLLTIGFLFKKLGRQLRYLAELCGVG
AVLPGTCGGGPRAAFPTGVKLLSYLYQEALHNCSNEHYPVLLSLLKTSCEPYTRFIHDWV
YSGVFRDAYGEFMIQVNHEYLSFRDKLYWTHGYVLISKEVEDCVPVFLKHIAHDIYVCGK
TINLLKLCCPRHYLCWSDVPVPRISVIFSLEELKEIEKDCAVYVGRMERVARHSSVSKEE
KELRMEIAKQELIAHAREAASRVLSALSDRQMSERMALDARKREQFQRLKEQFVKDQERR
QAARQEELDDDFSYARELRDRERRLKSLEEELERKARQALVDHYSKLSAEAARREQKALW
RIQRHRLESARLRFLLEDEKHIQEMLKAVSEAHQPQEPPDVLLSVHPQVTSPGPEHPEGG
QGCDSGSAEQHSPAWDGWNRPGLLTPQPLKPLAVGAGGRGLQQAEGARPFSDSLSIGDFL
PVGPGAEPSVQTGMVPLLEVALQTINLDLPPSAPGEAPAAASTQPSRPQEYDFSTVLRPA
VATSPAPGPLQAAECSLGSSGLQLWEDSCGKMDACGSASRETLLPSHPPRRAALEEGSSQ
PTERLFGQVSGGGLPTGDYASEIAPTRPRWNTHGHVSDASIRVGENVSDVAPTQPRWNTH
GHVSNASISLGESVSDVAPTRPRWNIHGHVSNASIRVGENVSDVAPTRPRWNTHGHVSNA
SIRVGENVSDVAPTRPRWNTHGHVSDASISLGESVSDMAPARPRWNTHGHVSDASISLGE
SVSDMAPTRPRWNTHGHVSDTSIRVGENVSDVAPIRSRCNTHGHVSDASISLGEPVSDVV
STRPRWNTHVPIPPPHMVLGALSPEAEPNTPRPQQSPPGHTSQSALSLGAQSTVLDCGPR
LPVEVGPSLSSPSSGCGEGSISVGENVSDVAPTQPWWPNTPGDSVSEELGPGRSGDTEDL
SPNWPLNSQEDTAAQSSPGRGEEAEASAAEAQGGEQAYLAGLAGQYHLERYPDSYESMSE
PPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLSELLTLPVLMKRSITAPLAAHISLVN
KAAVDYFFVELHLEAHYEALRHFLLMEDGEFAQSLSDLLFEKLGAGQTPGELLNPLVLNS
VLSKALQCSLHGDTPHASNLSLALKYLPEVFAPNAPDVLSCLELRYKVDWPLNIVITEGC
VSKYSGVFSFLLQLKLMMWALKDVCFHLKRTALLSHMAGSVQFRQLQLFKHEMQHFVKVI
QGYIANQILHVTWCEFRARLATVGDLEEIQRAHAEYLHKAVFRGLLTEKAAPVMNVIHSI
FSLVLKFRSQLISQAWGPPGGPRGAEHPNFALMQQSYNTFKYYSHFLFKVVTKLVNRGYQ
PHLEDFLLRINFNNYYQDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RT7	1.000	1.000	0.000	1819	1.000	1.000	Q96RT7.pdb.gz	GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6 PE=1 SV=3
2	AFDB:A0A0R4IYK8	0.372	0.403	2.646E-96	1678	0.388	0.420	A0A0R4IYK8.pdb.gz
3	PDB:7as4L	0.325	0.826	1.830E-56	679	0.372	0.996	7as4L.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
4	PDB:7qj0L	0.292	0.896	4.920E-41	566	0.308	0.991	7qj0L.pdb.gz
5	PDB:6x0uD	0.049	0.374	5.036E-13	158	0.086	0.987	6x0uD.pdb.gz
6	PDB:7as4B	0.154	0.435	3.080E-10	610	0.043	0.128	7as4B.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
7	PDB:6v6bB	0.155	0.472	5.215E-10	572	0.045	0.143	6v6bB.pdb.gz
8	PDB:7qj2G	0.146	0.390	5.215E-10	640	0.036	0.103	7qj2G.pdb.gz
9	PDB:3ripA	0.147	0.424	7.260E-9	568	0.038	0.121	3ripA.pdb.gz
10	PDB:7as4J	0.127	0.356	1.984E-8	601	0.038	0.115	7as4J.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
11	PDB:6v69I	0.150	0.471	4.698E-8	543	0.040	0.133	6v69I.pdb.gz
12	PDB:7m2wG	0.147	0.349	1.883E-7	712	0.031	0.080	7m2wG.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.
13	AFDB:Q8N137	0.058	0.097	9.474E-3	903	0.097	0.195	Q8N137.pdb.gz	CNTRB_HUMAN Centrobin OS=Homo sapiens OX=9606 GN=CNTROB PE=1 SV=1
14	AFDB:Q38B85	0.039	0.057	4.825E-2	973	0.063	0.117	Q38B85.pdb.gz	Q38B85_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1950 PE=4 SV=1
15	AFDB:Q54UC9	0.045	0.065	6.747E-2	1193	0.073	0.111	Q54UC9.pdb.gz	KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=kif3 PE=1 SV=1
16	AFDB:Q9SAF6	0.083	0.122	1.038E-1	1128	0.090	0.145	Q9SAF6.pdb.gz	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
17	AFDB:X2JC00	0.040	0.047	2.977E-1	1404	0.079	0.103	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
18	AFDB:Q2KN93	0.051	0.076	3.123E-1	1132	0.089	0.143	Q2KN93.pdb.gz	CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1la PE=2 SV=2
19	AFDB:Q09JY9	0.040	0.041	4.162E-1	1726	0.076	0.081	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
20	AFDB:Q8ND30	0.060	0.106	5.040E-1	876	0.053	0.111	Q8ND30.pdb.gz	LIPB2_HUMAN Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RT7	0.0	3742	1819	1.000	1.000	GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6 PE=1 SV=3
2	Q9GP62	2.67e-43	176	1351	0.053	0.072	Q9GP62_DROME Gamma tubulin ring protein OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1
3	Q8MT65	2.76e-43	176	1351	0.053	0.072	Q8MT65_DROME RE01412p OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1
4	Q9VTS3	3.01e-43	176	1351	0.053	0.072	Q9VTS3_DROME Grip163 OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=1 SV=2
5	Q9FG37	2.60e-22	107	838	0.041	0.089	GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana OX=3702 GN=GCP3 PE=1 SV=1
6	Q96RT8	5.62e-22	106	1024	0.054	0.096	GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens OX=9606 GN=TUBGCP5 PE=1 SV=1
7	Q96CW5	1.39e-17	92.0	907	0.048	0.097	GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3 PE=1 SV=2
8	Q9UGJ1	3.45e-15	83.6	667	0.035	0.094	GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens OX=9606 GN=TUBGCP4 PE=1 SV=1
9	Q9M350	4.63e-15	83.6	745	0.052	0.126	GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana OX=3702 GN=GCP4 PE=2 SV=2
10	B3DIU9	3.59e-14	80.5	668	0.035	0.094	B3DIU9_DANRE Gamma-tubulin complex component OS=Danio rerio OX=7955 GN=zgc:194580 PE=1 SV=1
11	Q9USQ2	6.85e-14	79.7	832	0.038	0.083	ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp6 PE=1 SV=2
12	Q9BSJ2	3.62e-13	77.4	902	0.049	0.099	GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens OX=9606 GN=TUBGCP2 PE=1 SV=2
13	Q5BEM5	8.03e-11	69.7	952	0.044	0.084	Q5BEM5_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01005 PE=3 SV=1
14	Q95ZG4	4.57e-10	67.4	813	0.041	0.091	SPC98_DICDI Spindle pole body component 98 OS=Dictyostelium discoideum OX=44689 GN=spc98 PE=1 SV=2
15	Q9XYP7	1.50e-09	65.5	852	0.032	0.069	GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster OX=7227 GN=Grip84 PE=1 SV=2
16	Q383E4	2.98e-08	61.2	799	0.032	0.073	Q383E4_TRYB2 Spindle pole body component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3150 PE=3 SV=1
17	Q95ZG3	8.39e-08	60.1	1335	0.021	0.028	SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum OX=44689 GN=spc97 PE=2 SV=2
18	Q9XYP8	6.37e-07	57.0	917	0.031	0.061	GCP3_DROME Gamma-tubulin complex component 3 OS=Drosophila melanogaster OX=7227 GN=Grip91 PE=1 SV=2
19	Q9C5H9	7.22e-06	53.5	678	0.029	0.078	GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
20	Q9VKU7	8.25e-06	53.1	650	0.034	0.095	GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster OX=7227 GN=Grip75 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15140 DUF4573	10	17.4	Domain of unknown function (DUF4573)
2	PF12497 ERbeta_N	1.3e+02	13.9	Estrogen receptor beta
3	PF19340 GCP6_N	2.4e-148	505.0	Gamma-tubulin complex component 6 N-terminus
4	PF04130 GCP_C_terminal	5.9e-54	195.2	Gamma tubulin complex component C-terminal
5	PF17681 GCP_N_terminal	4.8e-31	120.2	Gamma tubulin complex component N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251413	0.999	Tubulin gamma-1 chain
2	9606.ENSP00000260383	0.999	Gamma-tubulin complex component 4
3	9606.ENSP00000367049	0.999	Mitotic-spindle organizing protein 1
4	9606.ENSP00000446093	0.999	Gamma-tubulin complex component 2
5	9606.ENSP00000480316	0.999	Gamma-tubulin complex component 5
6	9606.ENSP00000261965	0.995	Gamma-tubulin complex component 3
7	9606.ENSP00000281871	0.994	Mitotic spindle organizing protein 2B
8	9606.ENSP00000451211	0.988	Protein NEDD1
9	9606.ENSP00000371308	0.975	Centromere protein J
10	9606.ENSP00000251412	0.952	Tubulin gamma-2 chain
11	9606.ENSP00000356785	0.933	Nucleoside diphosphate kinase 7
12	9606.ENSP00000418960	0.914	Breast cancer type 1 susceptibility protein
13	9606.ENSP00000311500	0.913	Mitotic spindle organizing protein 2A
14	9606.ENSP00000359398	0.905	Biogenesis of lysosome-related organelles complex 1 subunit 2
15	9606.ENSP00000458162	0.836	Actin, cytoplasmic 2
16	9606.ENSP00000343818	0.789	CDK5 regulatory subunit-associated protein 2
17	9606.ENSP00000270861	0.785	Serine/threonine-protein kinase PLK4
18	9606.ENSP00000262776	0.763	Galectin-3-binding protein
19	9606.ENSP00000353735	0.758	E3 ubiquitin-protein ligase Topors
20	9606.ENSP00000320797	0.741	Tubulin delta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006996	0.998	organelle organization
GO:0031109	0.976	microtubule polymerization or depolymerization
GO:0007020	0.970	microtubule nucleation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0032991	0.999	protein-containing complex
GO:0016020	0.998	membrane
GO:0000930	0.978	gamma-tubulin complex
GO:0000931	0.967	gamma-tubulin ring complex
GO:0043227	0.823	membrane-bounded organelle
GO:0043231	0.792	intracellular membrane-bounded organelle
GO:0005634	0.360	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]