StarFunc result for job id Q96RT8

User Input

>input (1024 residues)
MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHK
IEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDS
PSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSRE
DSGIQVDRTPLEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWTARPSQFPHSLHLHS
NLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNI
IVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRT
YQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGV
AEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWI
VHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQG
PSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESV
QSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDF
HEKFAGGDVCVDRSSESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYL
QAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSIS
FENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDV
LLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNY
IMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNL
ALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAG
MEQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RT8	1.000	1.000	0.000	1024	1.000	1.000	Q96RT8.pdb.gz	GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens OX=9606 GN=TUBGCP5 PE=1 SV=1
2	PDB:7as4J	0.536	0.897	3.733E-52	601	0.577	0.983	7as4J.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
3	PDB:7qj0J	0.485	0.910	1.808E-45	534	0.516	0.989	7qj0J.pdb.gz
4	AFDB:Q5AUB0	0.523	0.588	2.322E-31	905	0.184	0.208	Q5AUB0.pdb.gz	Q5AUB0_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08120 PE=3 SV=1
5	AFDB:Q9GP63	0.541	0.510	4.527E-29	1092	0.170	0.159	Q9GP63.pdb.gz	Q9GP63_DROME Gamma-tubulin complex component OS=Drosophila melanogaster OX=7227 GN=Grip128 PE=2 SV=1
6	AFDB:Q96CW5	0.462	0.517	1.505E-23	907	0.182	0.205	Q96CW5.pdb.gz	GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3 PE=1 SV=2
7	AFDB:Q9FG37	0.442	0.532	2.599E-22	838	0.165	0.202	Q9FG37.pdb.gz	GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana OX=3702 GN=GCP3 PE=1 SV=1
8	AFDB:Q383E4	0.453	0.565	5.793E-21	799	0.126	0.161	Q383E4.pdb.gz	Q383E4_TRYB2 Spindle pole body component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3150 PE=3 SV=1
9	AFDB:Q9USQ2	0.434	0.525	6.006E-20	832	0.150	0.185	Q9USQ2.pdb.gz	ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp6 PE=1 SV=2
10	AFDB:Q9VTS3	0.512	0.397	6.266E-20	1351	0.175	0.132	Q9VTS3.pdb.gz	Q9VTS3_DROME Grip163 OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=1 SV=2
11	AFDB:Q95ZG4	0.478	0.592	1.666E-19	813	0.140	0.176	Q95ZG4.pdb.gz	SPC98_DICDI Spindle pole body component 98 OS=Dictyostelium discoideum OX=44689 GN=spc98 PE=1 SV=2
12	AFDB:Q5BEM5	0.496	0.530	7.702E-19	952	0.152	0.164	Q5BEM5.pdb.gz	Q5BEM5_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01005 PE=3 SV=1
13	PDB:7as4L	0.496	0.727	2.859E-17	679	0.169	0.255	7as4L.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
14	PDB:7qj2G	0.441	0.678	4.702E-15	640	0.113	0.181	7qj2G.pdb.gz
15	PDB:7as4B	0.438	0.710	6.069E-15	610	0.119	0.200	7as4B.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
16	PDB:7qj0L	0.438	0.761	8.528E-15	566	0.148	0.269	7qj0L.pdb.gz
17	PDB:3ripA	0.406	0.677	1.757E-14	568	0.116	0.210	3ripA.pdb.gz
18	PDB:6v6bB	0.439	0.753	1.901E-13	572	0.134	0.240	6v6bB.pdb.gz
19	PDB:6v69I	0.419	0.737	7.733E-13	543	0.110	0.208	6v69I.pdb.gz
20	PDB:7m2wG	0.419	0.578	1.527E-12	712	0.109	0.157	7m2wG.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96RT8	0.0	2133	1024	1.000	1.000	GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens OX=9606 GN=TUBGCP5 PE=1 SV=1
2	Q96RT7	2.88e-22	106	1819	0.096	0.054	GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6 PE=1 SV=3
3	Q5AUB0	1.97e-17	90.1	905	0.078	0.088	Q5AUB0_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08120 PE=3 SV=1
4	Q9VTS3	1.45e-13	77.8	1351	0.099	0.075	Q9VTS3_DROME Grip163 OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=1 SV=2
5	Q9GP62	1.48e-13	77.8	1351	0.099	0.075	Q9GP62_DROME Gamma tubulin ring protein OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1
6	Q8MT65	1.56e-13	77.8	1351	0.099	0.075	Q8MT65_DROME RE01412p OS=Drosophila melanogaster OX=7227 GN=Grip163 PE=2 SV=1
7	Q96CW5	6.67e-13	75.5	907	0.071	0.080	GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3 PE=1 SV=2
8	Q9FG37	3.42e-09	63.5	838	0.063	0.078	GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana OX=3702 GN=GCP3 PE=1 SV=1
9	Q9M350	6.51e-09	62.4	745	0.151	0.208	GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana OX=3702 GN=GCP4 PE=2 SV=2
10	Q9VXU8	5.06e-08	59.7	1092	0.050	0.047	Q9VXU8_DROME Gamma-tubulin complex component OS=Drosophila melanogaster OX=7227 GN=Grip128 PE=3 SV=2
11	Q9GP63	5.28e-08	59.7	1092	0.050	0.047	Q9GP63_DROME Gamma-tubulin complex component OS=Drosophila melanogaster OX=7227 GN=Grip128 PE=2 SV=1
12	Q95SR3	5.80e-08	58.9	501	0.050	0.102	Q95SR3_DROME Gamma-tubulin complex component OS=Drosophila melanogaster OX=7227 GN=Grip128 PE=2 SV=1
13	Q9XYP7	7.78e-08	58.9	852	0.060	0.072	GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster OX=7227 GN=Grip84 PE=1 SV=2
14	Q9XYP8	9.01e-07	55.5	917	0.060	0.067	GCP3_DROME Gamma-tubulin complex component 3 OS=Drosophila melanogaster OX=7227 GN=Grip91 PE=1 SV=2
15	Q9USQ2	4.82e-06	53.1	832	0.062	0.077	ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp6 PE=1 SV=2
16	Q95ZG4	9.95e-06	52.0	813	0.064	0.081	SPC98_DICDI Spindle pole body component 98 OS=Dictyostelium discoideum OX=44689 GN=spc98 PE=1 SV=2
17	Q95ZG3	2.02e-05	51.2	1335	0.041	0.031	SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum OX=44689 GN=spc97 PE=2 SV=2
18	Q9VKU7	0.001	45.4	650	0.049	0.077	GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster OX=7227 GN=Grip75 PE=1 SV=2
19	Q383E4	0.002	44.7	799	0.035	0.045	Q383E4_TRYB2 Spindle pole body component OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3150 PE=3 SV=1
20	Q9Y705	0.003	44.3	784	0.035	0.046	SPC97_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18151 DUF5601	92	14.6	Domain of unknown function (DUF5601)
2	PF04130 GCP_C_terminal	2.4e-37	140.6	Gamma tubulin complex component C-terminal
3	PF17681 GCP_N_terminal	2.2e-21	88.4	Gamma tubulin complex component N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000248846	0.999	Gamma-tubulin complex component 6
2	9606.ENSP00000260383	0.999	Gamma-tubulin complex component 4
3	9606.ENSP00000367049	0.999	Mitotic-spindle organizing protein 1
4	9606.ENSP00000261965	0.998	Gamma-tubulin complex component 3
5	9606.ENSP00000281871	0.997	Mitotic spindle organizing protein 2B
6	9606.ENSP00000337618	0.997	Magnesium transporter NIPA2
7	9606.ENSP00000251413	0.996	Tubulin gamma-1 chain
8	9606.ENSP00000446093	0.996	Gamma-tubulin complex component 2
9	9606.ENSP00000311500	0.993	Mitotic spindle organizing protein 2A
10	9606.ENSP00000337452	0.993	Magnesium transporter NIPA1
11	9606.ENSP00000481038	0.992	Cytoplasmic FMR1-interacting protein 1
12	9606.ENSP00000356785	0.988	Nucleoside diphosphate kinase 7
13	9606.ENSP00000451211	0.983	Protein NEDD1
14	9606.ENSP00000251412	0.962	Tubulin gamma-2 chain
15	9606.ENSP00000371308	0.946	Centromere protein J
16	9606.ENSP00000314299	0.937	Complement factor H-related protein 1
17	9606.ENSP00000356395	0.937	Complement factor H-related protein 3
18	9606.ENSP00000418960	0.909	Breast cancer type 1 susceptibility protein
19	9606.ENSP00000359398	0.900	Biogenesis of lysosome-related organelles complex 1 subunit 2
20	9606.ENSP00000260453	0.893	Meiosis-specific nuclear structural protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0043015	0.362	gamma-tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0046785	0.975	microtubule polymerization
GO:0007020	0.971	microtubule nucleation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0000931	0.995	gamma-tubulin ring complex
GO:0043227	0.778	membrane-bounded organelle
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0016020	0.441	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]