StarFunc result for job id Q96RU2

User Input

>input (1077 residues)
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG
RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSV
SDQTSKESTSTESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINF
VKTCLQRWRSEIEQDIQDLKTCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGH
YWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAA
PTESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDYSTS
QEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVMLSPAMQGVIL
AIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKR
VVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSV
YLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKA
ASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAE
NLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RU2	1.000	1.000	0.000	1077	1.000	1.000	Q96RU2.pdb.gz	UBP28_HUMAN Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 PE=1 SV=1
2	AFDB:E7FD72	0.452	0.411	1.578E-91	1187	0.546	0.495	E7FD72.pdb.gz
3	AFDB:A0A2R8RR17	0.450	0.407	2.646E-91	1199	0.542	0.487	A0A2R8RR17.pdb.gz
4	AFDB:A0A2R8QB18	0.462	0.409	3.576E-91	1223	0.543	0.478	A0A2R8QB18.pdb.gz
5	AFDB:A0A0R4IQS2	0.582	0.546	1.195E-88	1162	0.500	0.464	A0A0R4IQS2.pdb.gz	A0A0R4IQS2_DANRE Ubiquitin carboxyl-terminal hydrolase 25 isoform X5 OS=Danio rerio OX=7955 GN=wu:fi33c05 PE=1 SV=1
6	AFDB:F8W4Z8	0.506	0.508	1.076E-85	1072	0.480	0.482	F8W4Z8.pdb.gz
7	AFDB:P57080	0.576	0.586	6.020E-85	1055	0.482	0.492	P57080.pdb.gz	UBP25_MOUSE Ubiquitin carboxyl-terminal hydrolase 25 OS=Mus musculus OX=10090 GN=Usp25 PE=1 SV=2
8	AFDB:E9QC12	0.333	0.344	2.118E-70	1041	0.461	0.477	E9QC12.pdb.gz
9	AFDB:Q01476	0.316	0.271	4.760E-20	1272	0.104	0.088	Q01476.pdb.gz	UBP2_YEAST Ubiquitin carboxyl-terminal hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP2 PE=1 SV=2
10	AFDB:Q9P3U0	0.327	0.310	1.227E-19	1141	0.103	0.097	Q9P3U0.pdb.gz	UBP2_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp2 PE=1 SV=1
11	PDB:7yxxA	0.274	0.172	2.219E-16	1754	0.138	0.085	7yxxA.pdb.gz
12	PDB:7qo48	0.261	0.718	2.039E-14	372	0.084	0.242	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
13	PDB:7w3ax	0.257	0.535	2.222E-14	494	0.088	0.192	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
14	PDB:5mpc8	0.256	0.661	2.877E-14	395	0.086	0.235	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
15	PDB:5k16B	0.241	0.749	8.441E-14	328	0.078	0.256	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
16	PDB:5cvnB	0.240	0.761	1.191E-13	321	0.069	0.231	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
17	PDB:3mhsA	0.236	0.527	3.809E-13	455	0.077	0.182	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
18	PDB:4wa6D	0.225	0.547	2.643E-12	415	0.078	0.202	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:5gjqx	0.255	0.733	4.626E-12	355	0.083	0.251	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:3ihpB	0.223	0.342	4.157E-11	681	0.076	0.120	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQS2	0.0	1043	1162	0.517	0.479	A0A0R4IQS2_DANRE Ubiquitin carboxyl-terminal hydrolase 25 isoform X5 OS=Danio rerio OX=7955 GN=wu:fi33c05 PE=1 SV=1
2	P57080	0.0	1004	1055	0.494	0.504	UBP25_MOUSE Ubiquitin carboxyl-terminal hydrolase 25 OS=Mus musculus OX=10090 GN=Usp25 PE=1 SV=2
3	Q7ZVQ4	0.0	1016	1072	0.502	0.505	Q7ZVQ4_DANRE Ubiquitin carboxyl-terminal hydrolase 25 OS=Danio rerio OX=7955 GN=wu:fi33c05 PE=1 SV=1
4	Q96RU2	0.0	2246	1077	1.000	1.000	UBP28_HUMAN Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 PE=1 SV=1
5	Q9UHP3	0.0	994	1055	0.494	0.504	UBP25_HUMAN Ubiquitin carboxyl-terminal hydrolase 25 OS=Homo sapiens OX=9606 GN=USP25 PE=1 SV=4
6	Q96B65	5.62e-63	223	450	0.125	0.300	Q96B65_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP25 PE=1 SV=1
7	A0A0R4IB93	1.84e-21	103	1047	0.075	0.077	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
8	Q86UV5	3.70e-16	86.3	1035	0.069	0.071	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
9	Q76LT8	2.22e-14	80.5	1036	0.068	0.070	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
10	Q9VC56	4.96e-13	76.6	3912	0.074	0.020	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
11	A0A0B4KHF3	5.00e-13	76.6	3921	0.074	0.020	A0A0B4KHF3_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
12	Q8IMW2	5.17e-13	76.6	3912	0.074	0.020	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
13	A0A0B4LIK5	5.77e-13	76.3	3921	0.074	0.020	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
14	A0A0B4KI06	6.78e-13	76.3	3930	0.074	0.020	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
15	Q9FPT1	1.54e-11	71.2	1116	0.069	0.066	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
16	P50101	5.43e-11	69.7	1230	0.074	0.065	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
17	Q84WU2	5.49e-11	69.3	1115	0.068	0.065	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
18	Q24574	6.62e-11	69.3	1556	0.064	0.044	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
19	Q9SCJ9	1.73e-10	67.8	1067	0.066	0.067	UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana OX=3702 GN=UBP26 PE=1 SV=3
20	Q70CQ2	4.06e-10	67.0	3546	0.071	0.022	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15992 DUF4769	1e+02	14.1	Domain of unknown function (DUF4769)
2	PF07720 TPR_3	5.9e+02	11.9	Tetratricopeptide repeat
3	PF14555 UBA_4	98	14.2	UBA-like domain
4	PF00443 UCH	3e-45	166.5	Ubiquitin carboxyl-terminal hydrolase
5	PF02809 UIM	1.8e+02	13.4	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000003302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371475	0.995	TP53-binding protein 1
2	9606.ENSP00000479618	0.985	Myc proto-oncogene protein
3	9606.ENSP00000441543	0.980	Polyubiquitin-C
4	9606.ENSP00000281708	0.963	F-box/WD repeat-containing protein 7
5	9606.ENSP00000312995	0.884	Claspin
6	9606.ENSP00000388107	0.841	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000272317	0.839	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000304697	0.837	Polyubiquitin-B
9	9606.ENSP00000261601	0.813	Ubiquitin carboxyl-terminal hydrolase 14
10	9606.ENSP00000229268	0.790	Ubiquitin carboxyl-terminal hydrolase 5
11	9606.ENSP00000321239	0.786	RING finger and CHY zinc finger domain-containing protein 1
12	9606.ENSP00000366819	0.771	Ubiquitin carboxyl-terminal hydrolase isozyme L3
13	9606.ENSP00000379721	0.771	Ubiquitin carboxyl-terminal hydrolase 8
14	9606.ENSP00000265560	0.766	Ubiquitin carboxyl-terminal hydrolase 4
15	9606.ENSP00000356981	0.749	Ubiquitin carboxyl-terminal hydrolase 21
16	9606.ENSP00000280377	0.746	Ubiquitin carboxyl-terminal hydrolase 15
17	9606.ENSP00000405965	0.744	Small ubiquitin-related modifier 2
18	9606.ENSP00000441214	0.722	Ubiquitin carboxyl-terminal hydrolase 36
19	9606.ENSP00000263966	0.721	Ubiquitin carboxyl-terminal hydrolase 13
20	9606.ENSP00000313811	0.717	Ubiquitin carboxyl-terminal hydrolase 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0019899	0.466	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0036211	0.987	protein modification process
GO:0009987	0.981	cellular process
GO:0050789	0.977	regulation of biological process
GO:0070647	0.974	protein modification by small protein conjugation or removal
GO:0050794	0.972	regulation of cellular process
GO:0006508	0.971	proteolysis
GO:0070646	0.955	protein modification by small protein removal
GO:0016579	0.954	protein deubiquitination
GO:0050896	0.922	response to stimulus
GO:0051716	0.840	cellular response to stimulus
GO:0007154	0.789	cell communication
GO:0023052	0.745	signaling
GO:0044237	0.650	cellular metabolic process
GO:0033554	0.554	cellular response to stress
GO:0007165	0.530	signal transduction
GO:0048519	0.498	negative regulation of biological process
GO:0048523	0.483	negative regulation of cellular process
GO:0019222	0.464	regulation of metabolic process
GO:0006974	0.445	cellular response to DNA damage stimulus
GO:0044260	0.437	cellular macromolecule metabolic process
GO:0060255	0.416	regulation of macromolecule metabolic process
GO:0009057	0.392	macromolecule catabolic process
GO:0035556	0.356	intracellular signal transduction
GO:0051171	0.340	regulation of nitrogen compound metabolic process
GO:0080090	0.333	regulation of primary metabolic process
GO:0044248	0.325	cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0005829	0.957	cytosol
GO:0016604	0.911	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]