StarFunc result for job id Q96RU3

User Input

>input (617 residues)
MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSK
EEEEYKYTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRH
QMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQ
VIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSP
KQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVDE
LNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLA
EVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFD
DEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGY
VPTSYVEVCLDKNAKDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96RU3	1.000	1.000	8.452E-84	617	1.000	1.000	Q96RU3.pdb.gz	FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2
2	AFDB:B7ZL14	0.499	0.557	1.485E-71	551	0.893	1.000	B7ZL14.pdb.gz	B7ZL14_HUMAN FNBP1 protein OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=1
3	AFDB:Q5T0N5	0.693	0.706	5.701E-55	605	0.566	0.577	Q5T0N5.pdb.gz	FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3
4	AFDB:Q8CJ53	0.636	0.649	4.408E-51	603	0.493	0.504	Q8CJ53.pdb.gz	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
5	AFDB:P97531	0.476	0.535	1.470E-47	547	0.468	0.528	P97531.pdb.gz	CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Trip10 PE=1 SV=3
6	AFDB:M9NF07	0.511	0.506	1.635E-40	623	0.366	0.363	M9NF07.pdb.gz	M9NF07_DROME Cdc42-interacting protein 4, isoform I OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
7	AFDB:W4VSQ9	0.483	0.502	5.629E-40	593	0.418	0.435	W4VSQ9.pdb.gz	W4VSQ9_HUMAN Thyroid hormone receptor interactor 10 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=1
8	AFDB:A8JNK4	0.468	0.435	1.270E-38	665	0.363	0.337	A8JNK4.pdb.gz	A8JNK4_DROME Cdc42-interacting protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
9	AFDB:M9PBP3	0.483	0.495	1.335E-38	602	0.361	0.370	M9PBP3.pdb.gz	M9PBP3_DROME Cdc42-interacting protein 4, isoform J OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
10	AFDB:Q19253	0.433	0.451	2.265E-32	592	0.269	0.280	Q19253.pdb.gz	TOCA1_CAEEL Transducer of Cdc42-dependent actin assembly protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=toca-1 PE=1 SV=2
11	PDB:3hajA	0.282	0.566	3.231E-8	286	0.078	0.168	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
12	PDB:6ikoA	0.385	0.754	3.567E-8	303	0.073	0.149	6ikoA.pdb.gz
13	PDB:1k9aB	0.089	0.123	6.085E-4	441	0.028	0.039	1k9aB.pdb.gz
14	PDB:3qwyA	0.097	0.338	1.102E-3	170	0.024	0.088	3qwyA.pdb.gz
15	PDB:1k0xA	0.092	0.473	3.986E-3	108	0.019	0.111	1k0xA.pdb.gz
16	PDB:3ehqA	0.088	0.275	1.072E-2	182	0.023	0.077	3ehqA.pdb.gz
17	PDB:2dybA	0.098	0.196	1.758E-2	298	0.021	0.044	2dybA.pdb.gz
18	PDB:2eyzA	0.100	0.195	2.039E-2	304	0.029	0.059	2eyzA.pdb.gz
19	PDB:2lqnA	0.092	0.181	2.485E-2	303	0.024	0.050	2lqnA.pdb.gz
20	PDB:2h8hA	0.081	0.112	3.344E-2	445	0.024	0.034	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZL14	0.0	1052	551	0.869	0.973	B7ZL14_HUMAN FNBP1 protein OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=1
2	H0Y7W6	0.0	1154	568	0.909	0.988	H0Y7W6_HUMAN Formin binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=3
3	Q15642	0.0	592	601	0.501	0.514	CIP4_HUMAN Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3
4	Q5T0N5	0.0	689	605	0.567	0.579	FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3
5	Q80TY0	0.0	1117	616	0.935	0.937	FNBP1_MOUSE Formin-binding protein 1 OS=Mus musculus OX=10090 GN=Fnbp1 PE=1 SV=2
6	Q8CJ53	0.0	587	603	0.494	0.506	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
7	Q8R511	0.0	1122	616	0.938	0.940	FNBP1_RAT Formin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fnbp1 PE=1 SV=2
8	Q96RU3	0.0	1285	617	1.000	1.000	FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2
9	A0A075B6Q2	1.78e-162	474	451	0.407	0.557	A0A075B6Q2_HUMAN Formin binding protein 1 like (Fragment) OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=1
10	W4VSQ9	1.20e-130	397	593	0.292	0.304	W4VSQ9_HUMAN Thyroid hormone receptor interactor 10 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=1
11	P97531	4.87e-130	394	547	0.295	0.333	CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Trip10 PE=1 SV=3
12	M9NF10	6.34e-116	360	624	0.378	0.373	M9NF10_DROME Cdc42-interacting protein 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
13	Q9VZD7	1.12e-115	360	631	0.374	0.366	Q9VZD7_DROME Cdc42-interacting protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=2 SV=2
14	Q8SYR8	1.65e-115	360	631	0.374	0.366	Q8SYR8_DROME RE39037p OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=2 SV=1
15	A8JNK4	3.46e-115	360	665	0.374	0.347	A8JNK4_DROME Cdc42-interacting protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
16	M9NE16	4.61e-115	358	612	0.374	0.377	M9NE16_DROME Cdc42-interacting protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
17	M9NF07	1.03e-114	357	623	0.374	0.371	M9NF07_DROME Cdc42-interacting protein 4, isoform I OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
18	M9ND44	1.32e-114	358	646	0.374	0.358	M9ND44_DROME Cdc42-interacting protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
19	M9PE52	7.80e-114	355	611	0.371	0.375	M9PE52_DROME Cdc42-interacting protein 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
20	M9ND42	3.14e-95	307	644	0.288	0.276	M9ND42_DROME Cdc42-interacting protein 4, isoform H OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	4.7e-14	63.8	Fes/CIP4, and EFC/F-BAR homology domain
2	PF02185 HR1	2	19.8	Hr1 repeat
3	PF14389 Lzipper-MIP1	95	14.7	Leucine-zipper of ternary complex factor MIP1
4	PF00018 SH3_1	2.4e-05	35.1	SH3 domain
5	PF18348 SH3_16	43	15.3	Bacterial dipeptidyl-peptidase Sh3 domain
6	PF07653 SH3_2	0.016	26.3	Variant SH3 domain
7	PF08239 SH3_3	0.084	24.6	Bacterial SH3 domain
8	PF14604 SH3_9	4e-05	34.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223023	0.980	Neural Wiskott-Aldrich syndrome protein
2	9606.ENSP00000365891	0.978	Wiskott-Aldrich syndrome protein
3	9606.ENSP00000479134	0.942	Formin-1
4	9606.ENSP00000383118	0.940	Cell division control protein 42 homolog
5	9606.ENSP00000368831	0.915	Sorting nexin-2
6	9606.ENSP00000373905	0.861	Dynamin-2
7	9606.ENSP00000473001	0.815	F-BAR domain only protein 1
8	9606.ENSP00000374455	0.812	Sequestosome-1
9	9606.ENSP00000271234	0.806	Formin-binding protein 1-like
10	9606.ENSP00000365312	0.804	Abl interactor 1
11	9606.ENSP00000393776	0.782	F-BAR domain only protein 2
12	9606.ENSP00000263773	0.767	Formin binding protein 4
13	9606.ENSP00000348602	0.739	Amphiphysin
14	9606.ENSP00000452746	0.732	Proline-serine-threonine phosphatase-interacting protein 1
15	9606.ENSP00000437271	0.720	182 kDa tankyrase-1-binding protein
16	9606.ENSP00000397351	0.719	Delphilin
17	9606.ENSP00000399259	0.714	FCH and double SH3 domains 1
18	9606.ENSP00000362014	0.707	Dynamin-1
19	9606.ENSP00000263246	0.704	Protein kinase C and casein kinase substrate in neurons protein 2
20	9606.ENSP00000394051	0.676	Nostrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.506	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0050789	0.961	regulation of biological process
GO:0050794	0.950	regulation of cellular process
GO:0032501	0.889	multicellular organismal process
GO:0048856	0.859	anatomical structure development
GO:0071840	0.745	cellular component organization or biogenesis
GO:0016043	0.736	cellular component organization
GO:0007275	0.651	multicellular organism development
GO:0051179	0.590	localization
GO:0050896	0.554	response to stimulus
GO:0048731	0.510	system development
GO:0051716	0.488	cellular response to stimulus
GO:0007399	0.487	nervous system development
GO:0051128	0.420	regulation of cellular component organization
GO:0007154	0.413	cell communication
GO:0023052	0.406	signaling
GO:0048518	0.401	positive regulation of biological process
GO:0051641	0.379	cellular localization
GO:0048522	0.309	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0031982	0.471	vesicle
GO:0012505	0.358	endomembrane system
GO:0005634	0.338	nucleus
GO:0097708	0.307	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]