StarFunc result for job id Q96RU7

User Input

>input (358 residues)
MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL
RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK
AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP
AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KR25	0.730	0.679	5.610E-61	385	1.000	0.930	J3KR25.pdb.gz	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
2	AFDB:Q8K4K2	0.744	0.752	2.967E-51	354	0.732	0.740	Q8K4K2.pdb.gz	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
3	AFDB:F1QCV8	0.771	0.793	1.186E-41	348	0.494	0.509	F1QCV8.pdb.gz
4	AFDB:Q28283	0.719	0.749	8.904E-39	343	0.430	0.449	Q28283.pdb.gz	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
5	AFDB:Q8K4K4	0.722	0.695	1.049E-36	372	0.436	0.419	Q8K4K4.pdb.gz	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
6	AFDB:A0A2R8QE16	0.711	0.729	7.465E-35	349	0.383	0.393	A0A2R8QE16.pdb.gz	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
7	AFDB:Q9V3Z1	0.579	0.438	2.126E-24	484	0.304	0.225	Q9V3Z1.pdb.gz	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
8	AFDB:A0A1D8PN61	0.630	0.373	2.804E-22	618	0.240	0.139	A0A1D8PN61.pdb.gz	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
9	AFDB:D6XE12	0.634	0.369	3.137E-22	631	0.215	0.122	D6XE12.pdb.gz	D6XE12_TRYB2 Serine/threonine protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.970 PE=4 SV=1
10	AFDB:O59697	0.651	0.555	4.914E-22	423	0.207	0.175	O59697.pdb.gz	PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk25 PE=1 SV=1
11	PDB:7myjC	0.639	0.498	1.211E-20	465	0.212	0.163	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:4zhxA	0.636	0.560	2.123E-20	409	0.204	0.178	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
13	PDB:5u6yA	0.612	0.485	2.811E-20	459	0.207	0.161	5u6yA.pdb.gz
14	PDB:5ufuA	0.641	0.622	2.371E-19	369	0.196	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:6b1uA	0.642	0.524	2.652E-19	442	0.209	0.170	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:3soaA	0.614	0.511	9.115E-19	436	0.179	0.147	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
17	PDB:5x3fB	0.591	0.606	2.000E-18	349	0.170	0.175	5x3fB.pdb.gz
18	PDB:4rerA	0.637	0.502	2.503E-18	459	0.198	0.155	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4d28C	0.588	0.743	3.707E-18	279	0.215	0.276	4d28C.pdb.gz
20	PDB:4rewA	0.638	0.558	3.707E-18	411	0.187	0.163	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KR25	0.0	722	385	1.000	0.930	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
2	Q96RU7	0.0	719	358	1.000	1.000	TRIB3_HUMAN Tribbles homolog 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=2
3	Q9WTQ6	4.55e-180	504	349	0.732	0.751	TRIB3_RAT Tribbles homolog 3 OS=Rattus norvegicus OX=10116 GN=Trib3 PE=2 SV=1
4	Q8K4K2	2.29e-172	485	354	0.737	0.746	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
5	Q6NY44	1.23e-113	336	348	0.480	0.494	Q6NY44_DANRE Tribbles homolog 3 OS=Danio rerio OX=7955 GN=zgc:76966 PE=2 SV=1
6	Q8K4K3	2.19e-99	299	343	0.447	0.466	TRIB2_MOUSE Tribbles homolog 2 OS=Mus musculus OX=10090 GN=Trib2 PE=2 SV=2
7	Q28283	2.22e-99	299	343	0.453	0.472	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
8	Q92519	2.24e-99	299	343	0.439	0.458	TRIB2_HUMAN Tribbles homolog 2 OS=Homo sapiens OX=9606 GN=TRIB2 PE=1 SV=1
9	Q96RU8	1.07e-91	281	372	0.391	0.376	TRIB1_HUMAN Tribbles homolog 1 OS=Homo sapiens OX=9606 GN=TRIB1 PE=1 SV=2
10	Q8K4K4	3.84e-91	279	372	0.394	0.379	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
11	A0A2R8QE16	9.66e-83	257	349	0.377	0.387	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
12	Q9V3Z1	8.11e-48	170	484	0.251	0.186	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
13	A0A1D8PN61	1.98e-30	124	618	0.254	0.147	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
14	Q00372	3.25e-28	117	612	0.221	0.129	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
15	Q91821	4.70e-28	117	651	0.182	0.100	MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis OX=8355 GN=melk PE=1 SV=2
16	Q14680	1.36e-27	115	651	0.179	0.098	MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK PE=1 SV=3
17	F1QGZ6	1.49e-27	115	676	0.193	0.102	MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio OX=7955 GN=melk PE=2 SV=1
18	Q61846	1.56e-27	115	643	0.179	0.100	MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus OX=10090 GN=Melk PE=1 SV=2
19	Q7TNL3	1.54e-26	111	435	0.179	0.147	STK40_MOUSE Serine/threonine-protein kinase 40 OS=Mus musculus OX=10090 GN=Stk40 PE=1 SV=1
20	Q8N2I9	1.60e-26	111	435	0.179	0.147	STK40_HUMAN Serine/threonine-protein kinase 40 OS=Homo sapiens OX=9606 GN=STK40 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	7.6e+02	10.8	Kinase-like
2	PF00069 Pkinase	3.2e-22	90.7	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	0.0024	28.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336790	0.998	Cyclic AMP-dependent transcription factor ATF-4
2	9606.ENSP00000448665	0.990	DNA damage-inducible transcript 3 protein
3	9606.ENSP00000398105	0.973	Glutathione-specific gamma-glutamylcyclotransferase 1
4	9606.ENSP00000305422	0.951	CCAAT/enhancer-binding protein beta
5	9606.ENSP00000451828	0.944	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000417401	0.938	Helicase with zinc finger domain 2
7	9606.ENSP00000284000	0.929	CCAAT/enhancer-binding protein gamma
8	9606.ENSP00000356641	0.928	E3 ubiquitin-protein ligase RFWD2
9	9606.ENSP00000385523	0.927	Peroxisome proliferator-activated receptor alpha
10	9606.ENSP00000375892	0.915	RAC-beta serine/threonine-protein kinase
11	9606.ENSP00000262367	0.911	CREB-binding protein
12	9606.ENSP00000217964	0.906	F-box-like/WD repeat-containing protein TBL1X
13	9606.ENSP00000399968	0.906	Nuclear receptor coactivator 2
14	9606.ENSP00000405574	0.906	F-box-like/WD repeat-containing protein TBL1XR1
15	9606.ENSP00000419692	0.905	Retinoic acid receptor RXR-alpha
16	9606.ENSP00000457466	0.905	Chromodomain-helicase-DNA-binding protein 9
17	9606.ENSP00000262188	0.903	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
18	9606.ENSP00000260129	0.902	Trimethylguanosine synthase
19	9606.ENSP00000325690	0.901	Histone-arginine methyltransferase CARM1
20	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004672	1.000	protein kinase activity
GO:0019900	0.999	kinase binding
GO:0004674	0.972	protein serine/threonine kinase activity
GO:0019901	0.859	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.991	regulation of metabolic process
GO:0009987	0.983	cellular process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0050896	0.978	response to stimulus
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051716	0.940	cellular response to stimulus
GO:0045936	0.924	negative regulation of phosphate metabolic process
GO:0044092	0.893	negative regulation of molecular function
GO:0001932	0.879	regulation of protein phosphorylation
GO:0051348	0.872	negative regulation of transferase activity
GO:0010605	0.849	negative regulation of macromolecule metabolic process
GO:0048518	0.817	positive regulation of biological process
GO:0010468	0.817	regulation of gene expression
GO:0051172	0.807	negative regulation of nitrogen compound metabolic process
GO:0010556	0.795	regulation of macromolecule biosynthetic process
GO:0031326	0.795	regulation of cellular biosynthetic process
GO:0048522	0.785	positive regulation of cellular process
GO:0009893	0.690	positive regulation of metabolic process
GO:0019219	0.664	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.602	positive regulation of macromolecule metabolic process
GO:0031325	0.602	positive regulation of cellular metabolic process
GO:0031400	0.581	negative regulation of protein modification process
GO:0008152	0.578	metabolic process
GO:0042326	0.576	negative regulation of phosphorylation
GO:0071704	0.561	organic substance metabolic process
GO:2001141	0.556	regulation of RNA biosynthetic process
GO:0007154	0.531	cell communication
GO:0051173	0.528	positive regulation of nitrogen compound metabolic process
GO:0043549	0.520	regulation of kinase activity
GO:0044238	0.512	primary metabolic process
GO:0006807	0.509	nitrogen compound metabolic process
GO:0023052	0.506	signaling
GO:0006355	0.487	regulation of DNA-templated transcription
GO:0044237	0.485	cellular metabolic process
GO:0007165	0.478	signal transduction
GO:0006950	0.455	response to stress
GO:0043170	0.454	macromolecule metabolic process
GO:0033554	0.450	cellular response to stress
GO:0006357	0.448	regulation of transcription by RNA polymerase II
GO:0042221	0.440	response to chemical
GO:1901564	0.433	organonitrogen compound metabolic process
GO:0009890	0.420	negative regulation of biosynthetic process
GO:0031327	0.414	negative regulation of cellular biosynthetic process
GO:0019538	0.405	protein metabolic process
GO:0045859	0.341	regulation of protein kinase activity
GO:0070887	0.330	cellular response to chemical stimulus
GO:0010033	0.318	response to organic substance
GO:0010646	0.310	regulation of cell communication
GO:0001933	0.307	negative regulation of protein phosphorylation
GO:0048583	0.305	regulation of response to stimulus
GO:0023051	0.300	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.997	cytosol
GO:0016020	0.972	membrane
GO:0005886	0.695	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]