StarFunc result for job id Q96RU8

User Input

>input (372 residues)
MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYL
SPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCK
VFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREE
EAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALS
DKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ
FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPE
YQEDSDISSFFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K4K4	0.799	0.799	5.453E-60	372	0.938	0.938	Q8K4K4.pdb.gz	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
2	AFDB:Q28283	0.683	0.740	1.670E-40	343	0.540	0.586	Q28283.pdb.gz	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
3	AFDB:A0A2R8QE16	0.696	0.741	7.560E-40	349	0.524	0.559	A0A2R8QE16.pdb.gz	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
4	AFDB:F1QCV8	0.704	0.752	5.560E-39	348	0.452	0.483	F1QCV8.pdb.gz
5	AFDB:Q8K4K2	0.679	0.713	8.518E-36	354	0.457	0.480	Q8K4K2.pdb.gz	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
6	AFDB:J3KR25	0.685	0.663	4.607E-34	385	0.430	0.416	J3KR25.pdb.gz	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
7	AFDB:Q9V3Z1	0.556	0.434	3.925E-24	484	0.328	0.252	Q9V3Z1.pdb.gz	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
8	AFDB:O13945	0.655	0.466	2.496E-22	532	0.220	0.154	O13945.pdb.gz	PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk9 PE=4 SV=1
9	AFDB:D6XE12	0.617	0.372	1.480E-21	631	0.237	0.139	D6XE12.pdb.gz	D6XE12_TRYB2 Serine/threonine protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.970 PE=4 SV=1
10	AFDB:Q38B72	0.625	0.328	1.836E-21	729	0.207	0.106	Q38B72.pdb.gz	Q38B72_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1760 PE=4 SV=1
11	PDB:4zhxA	0.631	0.575	2.811E-20	409	0.210	0.191	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
12	PDB:5u6yA	0.565	0.463	3.131E-20	459	0.210	0.170	5u6yA.pdb.gz
13	PDB:4rewA	0.625	0.569	7.030E-20	411	0.218	0.197	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
14	PDB:7myjC	0.633	0.512	7.030E-20	465	0.231	0.185	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:5ufuA	0.629	0.634	1.856E-19	369	0.196	0.198	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:6b1uA	0.621	0.526	1.856E-19	442	0.220	0.186	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4rerA	0.643	0.527	1.959E-19	459	0.204	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:3soaA	0.593	0.511	2.341E-18	436	0.210	0.179	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
19	PDB:4cztD	0.550	0.668	7.264E-18	302	0.215	0.265	4cztD.pdb.gz
20	PDB:4d28C	0.562	0.730	9.012E-18	279	0.215	0.287	4d28C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4K4	0.0	686	372	0.938	0.938	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
2	Q96RU8	0.0	757	372	1.000	1.000	TRIB1_HUMAN Tribbles homolog 1 OS=Homo sapiens OX=9606 GN=TRIB1 PE=1 SV=2
3	Q28283	1.53e-134	389	343	0.535	0.580	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
4	Q92519	8.67e-134	387	343	0.532	0.577	TRIB2_HUMAN Tribbles homolog 2 OS=Homo sapiens OX=9606 GN=TRIB2 PE=1 SV=1
5	Q8K4K3	1.84e-132	384	343	0.527	0.571	TRIB2_MOUSE Tribbles homolog 2 OS=Mus musculus OX=10090 GN=Trib2 PE=2 SV=2
6	A0A2R8QE16	5.84e-132	383	349	0.511	0.544	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
7	Q6NY44	2.50e-110	328	348	0.454	0.486	Q6NY44_DANRE Tribbles homolog 3 OS=Danio rerio OX=7955 GN=zgc:76966 PE=2 SV=1
8	Q9WTQ6	1.22e-99	301	349	0.449	0.479	TRIB3_RAT Tribbles homolog 3 OS=Rattus norvegicus OX=10116 GN=Trib3 PE=2 SV=1
9	Q8K4K2	3.56e-97	295	354	0.417	0.438	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
10	Q96RU7	3.94e-91	279	358	0.379	0.394	TRIB3_HUMAN Tribbles homolog 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=2
11	J3KR25	7.61e-91	280	385	0.379	0.366	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
12	Q9V3Z1	3.81e-55	190	484	0.290	0.223	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
13	Q38997	1.63e-36	140	512	0.261	0.189	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3
14	Q582S9	4.16e-36	134	286	0.207	0.269	Q582S9_TRYB2 Serine/threonine protein kinase, putative (Fragment) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.3.4560 PE=3 SV=1
15	B9DFC1	6.76e-36	139	512	0.258	0.188	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
16	Q54YF2	9.64e-35	137	727	0.266	0.136	AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum OX=44689 GN=snfA PE=2 SV=1
17	O74536	5.01e-34	134	576	0.194	0.125	SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssp2 PE=1 SV=1
18	D6XE12	1.04e-33	134	631	0.207	0.122	D6XE12_TRYB2 Serine/threonine protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.970 PE=4 SV=1
19	Q57YE4	1.41e-33	128	296	0.188	0.236	Q57YE4_TRYB2 Serine/threonine kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.490 PE=3 SV=1
20	P92958	2.83e-33	131	512	0.226	0.164	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	0.11	23.4	Kinase-like
2	PF00069 Pkinase	3.6e-29	113.5	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	3.6e-11	54.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427514	0.977	CCAAT/enhancer-binding protein alpha
2	9606.ENSP00000302486	0.943	Dual specificity mitogen-activated protein kinase kinase 1
3	9606.ENSP00000239938	0.938	Early growth response protein 1
4	9606.ENSP00000356641	0.926	E3 ubiquitin-protein ligase RFWD2
5	9606.ENSP00000362222	0.895	Serine/threonine-protein kinase 40
6	9606.ENSP00000264716	0.785	Fos-related antigen 2
7	9606.ENSP00000320886	0.767	Carbohydrate-responsive element-binding protein
8	9606.ENSP00000483356	0.739	RIB43A domain with coiled-coils 2
9	9606.ENSP00000305422	0.706	CCAAT/enhancer-binding protein beta
10	9606.ENSP00000360170	0.704	Angiopoietin-related protein 3
11	9606.ENSP00000155926	0.699	Tribbles homolog 2
12	9606.ENSP00000456340	0.691	DET1 homolog
13	9606.ENSP00000355632	0.668	Polypeptide N-acetylgalactosaminyltransferase 2
14	9606.ENSP00000260210	0.662	BUD13 homolog
15	9606.ENSP00000303709	0.658	Ubiquitin-conjugating enzyme E2 E1
16	9606.ENSP00000291495	0.653	Cartilage intermediate layer protein 2
17	9606.ENSP00000445002	0.650	Apolipoprotein A-V
18	9606.ENSP00000445920	0.644	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
19	9606.ENSP00000345445	0.601	Sorting and assembly machinery component 50 homolog
20	9606.ENSP00000295822	0.583	Eukaryotic translation initiation factor 5A-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004672	0.999	protein kinase activity
GO:0098772	0.996	molecular function regulator activity
GO:0019899	0.996	enzyme binding
GO:0004674	0.924	protein serine/threonine kinase activity
GO:0008134	0.859	transcription factor binding
GO:0030234	0.851	enzyme regulator activity
GO:0140297	0.849	DNA-binding transcription factor binding
GO:0061629	0.753	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.986	cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0019222	0.974	regulation of metabolic process
GO:0048518	0.936	positive regulation of biological process
GO:0051338	0.932	regulation of transferase activity
GO:0044092	0.879	negative regulation of molecular function
GO:0051716	0.842	cellular response to stimulus
GO:0031399	0.835	regulation of protein modification process
GO:0048522	0.828	positive regulation of cellular process
GO:0048523	0.814	negative regulation of cellular process
GO:0009893	0.813	positive regulation of metabolic process
GO:0009892	0.807	negative regulation of metabolic process
GO:0002683	0.796	negative regulation of immune system process
GO:0010468	0.786	regulation of gene expression
GO:0031323	0.771	regulation of cellular metabolic process
GO:0051173	0.741	positive regulation of nitrogen compound metabolic process
GO:0010604	0.735	positive regulation of macromolecule metabolic process
GO:1903320	0.721	regulation of protein modification by small protein conjugation or removal
GO:0008152	0.690	metabolic process
GO:0051239	0.662	regulation of multicellular organismal process
GO:0031325	0.659	positive regulation of cellular metabolic process
GO:0009889	0.658	regulation of biosynthetic process
GO:0031326	0.653	regulation of cellular biosynthetic process
GO:0009605	0.637	response to external stimulus
GO:0051093	0.635	negative regulation of developmental process
GO:0071704	0.620	organic substance metabolic process
GO:0010605	0.612	negative regulation of macromolecule metabolic process
GO:0042221	0.610	response to chemical
GO:0044237	0.574	cellular metabolic process
GO:0010033	0.568	response to organic substance
GO:0044238	0.567	primary metabolic process
GO:0051247	0.555	positive regulation of protein metabolic process
GO:0045595	0.554	regulation of cell differentiation
GO:0006807	0.483	nitrogen compound metabolic process
GO:0019219	0.481	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.479	macromolecule metabolic process
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0009607	0.462	response to biotic stimulus
GO:0007154	0.443	cell communication
GO:0031396	0.438	regulation of protein ubiquitination
GO:0023052	0.431	signaling
GO:0051252	0.427	regulation of RNA metabolic process
GO:0031401	0.422	positive regulation of protein modification process
GO:1903322	0.410	positive regulation of protein modification by small protein conjugation or removal
GO:0007165	0.408	signal transduction
GO:0006355	0.408	regulation of DNA-templated transcription
GO:1901564	0.404	organonitrogen compound metabolic process
GO:0045596	0.378	negative regulation of cell differentiation
GO:0009894	0.344	regulation of catabolic process
GO:1903050	0.339	regulation of proteolysis involved in protein catabolic process
GO:0044419	0.325	biological process involved in interspecies interaction between organisms
GO:0032501	0.319	multicellular organismal process
GO:0045862	0.313	positive regulation of proteolysis
GO:0031331	0.305	positive regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.958	cytosol
GO:0070013	0.848	intracellular organelle lumen
GO:0031981	0.799	nuclear lumen
GO:0005654	0.725	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]