StarFunc result for job id Q96RV3

User Input

>input (2341 residues)
MGSQTLQILRQGVWAALSGGWYYDPHQATFVNALHLYLWLFLLGLPFTLYMALPSTMIIV
AVYCPVIAAVFIVLKMVNYRLHRALDAGEVVDRTANEFTDQRTKAEQGNCSTRRKDSNGP
SDPGGGIEMSEFIREATPPVGCSSRNSYAGLDPSNQIGSGSSRLGTAATIKGDTDTAKTS
DDISLSLGQSSSLCKEGSEEQDLAADRKLFRLVSNDSFISIQPSLSSCGQDLPRDFSDKV
NLPSHNHHHHVDQSLSSACDTEVASLVPLHSHSYRKDHRPRGVPRTSSSAVAFPDTSLND
FPLYQQRRGLDPVSELESSKPLSGSKESLVENSGLSGEFQLAGDLKINTSQPPTKSGKSK
PLKAEKSMDSLRSLSTRSSGSTESYCSGTDRDTNSTVSSYKSEQTSSTHIESILSEHEES
PKAGTKSGRKKECCAGPEEKNSCASDKRTSSEKIAMEASTNSGVHEAKDPTPSDEMHNQR
GLSTSASEEANKNPHANEFTSQGDRPPGNTAENKEEKSDKSAVSVDSKVRKDVGGKQKEG
DVRPKSSSVIHRTASAHKSGRRRTGKKRASSFDSSRHRDYVCFRGVSGTKPHSAIFCHDE
DSSDQSDLSRASSVQSAHQFSSDSSSSTTSHSCQSPEGRYSALKTKHTHKERGTDSEHTH
KAHLVPEGTSKKRATRRTSSTNSAKTRARVLSLDSGTVACLNDSNRLMAPESIKPLTTSK
SDLEAKEGEVLDELSLLGRASQLETVTRSRNSLPNQVAFPEGEEQDAVSGAAQASEEAVS
FRRERSTFRRQAVRRRHNAGSNPTPPTLLIGSPLSLQDGQQGQQSTAQVKVQSRPPSQAA
VLSASASLLVRNGSVHLEASHDNASAVGGSSLHDELGKFSSTLYETGGCDMSLVNFEPAA
RRASNICDTDSHVSSSTSVRFYPHDVLSLPQIRLNRLLTIDTDLLEQQDIDLSPDLAATY
GPTEEAAQKVKHYYRFWILPQLWIGINFDRLTLLALFDRNREILENVLAVILAILVAFLG
SILLIQGFFRDIWVFQFCLVIASCQYSLLKSVQPDSSSPRHGHNRIIAYSRPVYFCICCG
LIWLLDYGSRNLTATKFKLYGITFTNPLVFISARDLVIVFTLCFPIVFFIGLLPQVNTFV
MYLCEQLDIHIFGGNATTSLLAALYSFICSIVAVALLYGLCYGALKDSWDGQHIPVLFSI
FCGLLVAVSYHLSRQSSDPSVLFSLVQSKIFPKTEEKNPEDPLSEVKDPLPEKLRNSVSE
RLQSDLVVCIVIGVLYFAIHVSTVFTVLQPALKYVLYTLVGFVGFVTHYVLPQVRKQLPW
HCFSHPLLKTLEYNQYEVRNAATMMWFEKLHVWLLFVEKNIIYPLIVLNELSSSAETIAS
PKKLNTELGALMITVAGLKLLRSSFSSPTYQYVTVIFTVLFFKFDYEAFSETMLLDLFFM
SILFNKLWELLYKLQFVYTYIAPWQITWGSAFHAFAQPFAVPHSAMLFIQAAVSAFFSTP
LNPFLGSAIFITSYVRPVKFWERDYNTKRVDHSNTRLASQLDRNPGSDDNNLNSIFYEHL
TRSLQHSLCGDLLLGRWGNYSTGDCFILASDYLNALVHLIEIGNGLVTFQLRGLEFRGTY
CQQREVEAITEGVEEDEGFCCCEPGHIPHMLSFNAAFSQRWLAWEVIVTKYILEGYSITD
NSAASMLQVFDLRKVLTTYYVKGIIYYVTTSSKLEEWLANETMQEGLRLCADRNYVDVDP
TFNPNIDEDYDHRLAGISRESFCVIYLNWIEYCSSRRAKPVDVDKDSSLVTLCYGLCVLG
RRALGTASHHMSSNLESFLYGLHALFKGDFRISSIRDEWIFADMELLRKVVVPGIRMSIK
LHQDHFTSPDEYDDPTVLYEAIVSHEKNLVIAHEGDPAWRSAVLANSPSLLALRHVMDDG
TNEYKIIMLNRRYLSFRVIKVNKECVRGLWAGQQQELVFLRNRNPERGSIQNAKQALRNM
INSSCDQPIGYPIFVSPLTTSYSDSHEQLKDILGGPISLGNIRNFIVSTWHRLRKGCGAG
CNSGGNIEDSDTGGGTSCTGNNATTANNPHSNVTQGSIGNPGQGSGTGLHPPVTSYPPTL
GTSHSSHSVQSGLVRQSPARASVASQSSYCYSSRHSSLRMSTTGFVPCRRSSTSQISLRN
LPSSIQSRLSMVNQMEPSGQSGLACVQHGLPSSSSSSQSIPACKHHTLVGFLATEGGQSS
ATDAQPGNTLSPANNSHSRKAEVIYRVQIVDPSQILEGINLSKRKELQWPDEGIRLKAGR
NSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAE
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NKB5	0.520	0.569	0.000	2137	0.400	0.438	A6NKB5.pdb.gz	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	AFDB:Q4GYI9	0.046	0.054	9.102E-4	1737	0.094	0.127	Q4GYI9.pdb.gz	Q4GYI9_TRYB2 Fusaric acid resistance protein-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3880 PE=4 SV=1
3	AFDB:Q9W517	0.053	0.062	1.164E-1	1741	0.090	0.121	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
4	AFDB:E5FYH1	0.048	0.054	3.469E-1	1653	0.097	0.137	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
5	PDB:4iggB	0.045	0.096	3.779E-1	771	0.038	0.114	4iggB.pdb.gz
6	AFDB:E1JI78	0.032	0.031	9.154E-1	2528	0.084	0.078	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
7	PDB:7r04B	0.049	0.051	1.038	2229	0.053	0.056	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
8	PDB:5t1aA	0.030	0.088	1.271	445	0.024	0.128	5t1aA.pdb.gz	Structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists.
9	AFDB:B9ZSJ2	0.038	0.049	1.371	1463	0.068	0.109	B9ZSJ2.pdb.gz	B9ZSJ2_PLAF7 Exported protein family 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0114000 PE=4 SV=1
10	AFDB:Q80XI3	0.032	0.040	1.487	1579	0.057	0.084	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
11	PDB:5djqA	0.057	0.149	1.687	466	0.020	0.101	5djqA.pdb.gz	The structure of cbb3 cytochrome oxidase provides insights into proton pumping.
12	PDB:6bcuA	0.053	0.055	1.687	2204	0.049	0.052	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
13	PDB:5jyfB	0.019	0.114	1.756	294	0.005	0.037	5jyfB.pdb.gz
14	PDB:5utmA	0.018	0.095	1.904	345	0.006	0.038	5utmA.pdb.gz	Mutant Structures of Streptococcus agalactiae GAPDH
15	PDB:4ybqB	0.036	0.111	1.983	462	0.020	0.102	4ybqB.pdb.gz
16	AFDB:Q96L73	0.020	0.019	2.055	2696	0.067	0.058	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
17	PDB:7jwkC	0.017	0.097	2.065	333	0.006	0.042	7jwkC.pdb.gz	Crystal Structure of Glyceraldehyde-3-phosphate Dehydrogenase (GAPDH) from Mycoplasma genitalium with bound NAD
18	AFDB:Q4LDP4	0.041	0.045	2.228	1931	0.106	0.128	Q4LDP4.pdb.gz	Q4LDP4_DROME Testis-specific gamma-tubulin ring protein 91 OS=Drosophila melanogaster OX=7227 GN=t-Grip91 PE=4 SV=1
19	AFDB:Q5JV73	0.031	0.037	2.619	1810	0.081	0.104	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
20	PDB:6fuyA	0.043	0.075	3.093	961	0.037	0.089	6fuyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NKB5	0.0	1501	2137	0.307	0.336	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	P18490	0.0	755	3413	0.138	0.095	PCX_DROME Protein pecanex OS=Drosophila melanogaster OX=7227 GN=pcx PE=2 SV=4
3	Q63HM2	2.94e-12	75.1	1172	0.021	0.043	PCX4_HUMAN Pecanex-like protein 4 OS=Homo sapiens OX=9606 GN=PCNX4 PE=1 SV=4
4	Q18879	0.46	37.7	351	0.007	0.046	CAV2_CAEEL Caveolin-2 OS=Caenorhabditis elegans OX=6239 GN=cav-2 PE=2 SV=3
5	Q8I132	1.6	36.2	446	0.007	0.036	Q8I132_CAEEL Chloride channel CLIC-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=ooc-3 PE=1 SV=1
6	Q9XVW6	1.7	36.2	448	0.007	0.036	Q9XVW6_CAEEL Chloride channel CLIC-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=ooc-3 PE=1 SV=1
7	Q9LF88	2.0	35.8	479	0.035	0.171	Y3304_ARATH Late embryogenesis abundant protein At3g53040 OS=Arabidopsis thaliana OX=3702 GN=At3g53040 PE=2 SV=1
8	P03748	2.5	35.8	553	0.008	0.033	FIBER_BPT7 Tail fiber protein OS=Escherichia phage T7 OX=10760 GN=17 PE=1 SV=1
9	O14319	2.6	35.4	569	0.021	0.088	CUE5_SCHPO CUE domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.02c PE=4 SV=1
10	A8MU46	2.7	35.4	494	0.020	0.093	SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens OX=9606 GN=SMTNL1 PE=1 SV=2
11	A0A2R8Y4T4	4.6	34.7	335	0.010	0.072	A0A2R8Y4T4_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=1
12	Q28264	4.6	33.9	210	0.010	0.114	Q28264_CANLF Junctional sarcoplasmic reticulum protein OS=Canis lupus familiaris OX=9615 PE=2 SV=1
13	A0A0G2K677	4.7	35.0	2561	0.014	0.013	A0A0G2K677_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=1 SV=1
14	A0A8I6ASR7	5.2	35.0	2542	0.014	0.013	A0A8I6ASR7_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=3 SV=1
15	P06837	5.9	33.9	227	0.015	0.154	NEUM_MOUSE Neuromodulin OS=Mus musculus OX=10090 GN=Gap43 PE=1 SV=1
16	E9PX29	8.4	34.3	2561	0.014	0.013	E9PX29_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
17	Q8VIE5	8.6	34.3	2561	0.014	0.013	Q8VIE5_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=2 SV=1
18	Q91ZE6	8.6	34.3	2555	0.014	0.013	Q91ZE6_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05041 Pecanex_C	6.3e-116	397.3	Pecanex protein (C-terminus)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304192

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000450832	0.705	Signal-induced proliferation-associated 1-like protein 1
2	9606.ENSP00000382163	0.697	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
3	9606.ENSP00000290349	0.665	Carbonyl reductase [NADPH] 1
4	9606.ENSP00000157600	0.650	LIM and cysteine-rich domains protein 1
5	9606.ENSP00000321266	0.641	Phosphatidylinositol transfer protein beta isoform
6	9606.ENSP00000262794	0.628	RNA helicase Mov10l1
7	9606.ENSP00000379226	0.621	Testis-expressed protein 11
8	9606.ENSP00000348132	0.611	Serine/threonine kinase 31
9	9606.ENSP00000265018	0.610	Protein FAM184B
10	9606.ENSP00000356429	0.578	Regulator of G-protein signaling 1
11	9606.ENSP00000353013	0.563	C-type lectin domain containing 14A
12	9606.ENSP00000260643	0.513	Prolactin regulatory element-binding protein
13	9606.ENSP00000345008	0.510	Fibulin-5
14	9606.ENSP00000299957	0.508	Protein CASC4
15	9606.ENSP00000412999	0.503	Zinc finger protein 805

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.936	biological regulation
GO:0009987	0.851	cellular process
GO:0050789	0.782	regulation of biological process
GO:0050896	0.320	response to stimulus
GO:0050794	0.320	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.973	intracellular organelle
GO:0043227	0.935	membrane-bounded organelle
GO:0016020	0.878	membrane
GO:0043231	0.863	intracellular membrane-bounded organelle
GO:0012505	0.749	endomembrane system
GO:0005783	0.533	endoplasmic reticulum
GO:0071944	0.518	cell periphery
GO:0005886	0.401	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]