StarFunc result for job id Q96RW7

User Input

>input (1400 residues)
MISWEVVHTVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLHELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPHRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIAKVTLSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVALGDITV
MECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTC
VASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGEL
ISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLP
VITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQE
PPTVEDLEPPYNTTFQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISILEDG
TLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNL
FCEVEGTPSPIIMWYKDNVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EY71	0.218	0.376	6.202E-95	783	0.301	0.539	E7EY71.pdb.gz
2	AFDB:Q3V1M1	0.132	0.084	2.387E-68	2594	0.161	0.087	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
3	AFDB:Q6WRI0	0.151	0.098	1.376E-67	2623	0.175	0.093	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
4	AFDB:E7F5U2	0.145	0.090	4.159E-66	2497	0.164	0.092	E7F5U2.pdb.gz
5	AFDB:Q6WRH9	0.136	0.084	6.678E-66	2597	0.161	0.087	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
6	AFDB:F1NY98	0.257	0.191	2.357E-55	2034	0.164	0.113	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
7	AFDB:Q4VA61	0.256	0.186	2.849E-55	2053	0.155	0.106	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
8	AFDB:A0A2R8QL08	0.151	0.115	2.898E-54	2036	0.180	0.124	A0A2R8QL08.pdb.gz
9	AFDB:Q9NEG0	0.118	0.176	5.456E-53	907	0.135	0.208	Q9NEG0.pdb.gz	Q9NEG0_DROME EG:BACR25B3.10 protein OS=Drosophila melanogaster OX=7227 GN=trol PE=4 SV=1
10	AFDB:Q9VS29	0.239	0.178	3.458E-52	2074	0.159	0.107	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
11	PDB:5oj2B	0.137	0.246	5.483E-30	692	0.104	0.211	5oj2B.pdb.gz
12	PDB:1e07A	0.183	0.341	8.325E-25	642	0.088	0.192	1e07A.pdb.gz
13	PDB:5a42A	0.087	0.079	1.372E-17	1597	0.089	0.078	5a42A.pdb.gz
14	PDB:7sqcO0	0.091	0.106	1.463E-16	1140	0.074	0.090	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:6dldD	0.142	0.567	1.799E-15	269	0.050	0.260	6dldD.pdb.gz
16	PDB:4ziqA	0.090	0.088	1.886E-15	1450	0.076	0.073	4ziqA.pdb.gz
17	PDB:6dlfA	0.133	0.619	7.225E-14	236	0.049	0.292	6dlfA.pdb.gz
18	PDB:7q1yA	0.110	0.111	1.402E-13	1374	0.061	0.063	7q1yA.pdb.gz
19	PDB:6h03A	0.092	0.100	1.694E-13	1223	0.069	0.078	6h03A.pdb.gz
20	PDB:4aq1A	0.078	0.127	2.360E-13	721	0.064	0.123	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AJ76	0.0	1221	5100	0.453	0.124	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
2	D3YXG0	0.0	2560	5634	0.888	0.221	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
3	E7F3V2	0.0	1312	4212	0.491	0.163	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
4	G5ED27	0.0	788	5175	0.344	0.093	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
5	G5EDG4	0.0	788	3962	0.344	0.121	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
6	G5EG33	0.0	788	5198	0.344	0.093	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
7	Q8NDA2	0.0	1251	5059	0.454	0.126	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
8	Q96RW7	0.0	2865	5635	1.000	0.248	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
9	Q6WRI0	8.98e-80	294	2623	0.180	0.096	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
10	Q8WZ42	9.46e-80	294	34350	0.187	0.008	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
11	Q9NR99	1.15e-79	293	2828	0.176	0.087	MXRA5_HUMAN Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3
12	A2ASS6	1.27e-79	294	35213	0.189	0.008	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
13	Q7TN00	6.73e-78	288	3410	0.196	0.080	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
14	A0A8I5ZUN3	1.62e-77	287	35375	0.197	0.008	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
15	Q3V1M1	1.10e-75	281	2594	0.180	0.097	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
16	Q6WRH9	8.51e-72	268	2597	0.171	0.092	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
17	O01761	1.43e-71	268	8081	0.200	0.035	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
18	P98160	2.45e-64	244	4391	0.188	0.060	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
19	A0A8I6A2S5	3.13e-58	225	4402	0.182	0.058	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
20	A0A8I6ASH2	4.75e-58	224	4387	0.182	0.058	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.0013	30.3	Immunoglobulin C1-set domain
2	PF05790 C2-set	4.5	18.9	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	1.4e-16	71.6	CD80-like C2-set immunoglobulin domain
4	PF02480 Herpes_gE	11	16.9	Alphaherpesvirus glycoprotein E
5	PF20418 Herpes_gE_N	0.2	22.9	Alphaherpesvirus glycoprotein E N-terminal
6	PF07679 I-set	8.4e-156	517.9	Immunoglobulin I-set domain
7	PF00047 ig	2.4e-92	314.6	Immunoglobulin domain
8	PF13895 Ig_2	7.2e-94	319.5	Immunoglobulin domain
9	PF13927 Ig_3	4.7e-141	471.0	Immunoglobulin domain
10	PF18452 Ig_6	4.6e-07	41.1	Immunoglobulin domain
11	PF17736 Ig_C17orf99	3.6e-10	51.1	C17orf99 Ig domain
12	PF16706 Izumo-Ig	2e-06	38.9	Izumo-like Immunoglobulin domain
13	PF11465 Receptor_2B4	6.8e-08	44.0	Natural killer cell receptor 2B4
14	PF07686 V-set	7e-51	182.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436682	0.906	Age-related maculopathy susceptibility 2
2	9606.ENSP00000326330	0.821	Fraser extracellular matrix complex subunit 1
3	9606.ENSP00000412940	0.740	FRAS1-related extracellular matrix protein 1
4	9606.ENSP00000280481	0.727	FRAS1-related extracellular matrix protein 2
5	9606.ENSP00000299367	0.608	Complement C2
6	9606.ENSP00000357986	0.608	Pleckstrin homology domain-containing family A member 1
7	9606.ENSP00000332886	0.590	FRAS1-related extracellular matrix protein 3
8	9606.ENSP00000370745	0.586	ATP-dependent RNA helicase DDX1
9	9606.ENSP00000386665	0.586	Four and a half LIM domains protein 2
10	9606.ENSP00000376708	0.554	Von Willebrand factor A domain containing 2
11	9606.ENSP00000450456	0.540	Retina and anterior neural fold homeobox protein 2
12	9606.ENSP00000356224	0.537	Nesprin-1
13	9606.ENSP00000367196	0.532	Golgi-associated plant pathogenesis-related protein 1
14	9606.ENSP00000356399	0.518	Complement factor H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.993	extracellular matrix structural constituent
GO:0042802	0.342	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.988	cellular component organization
GO:0031532	0.657	actin cytoskeleton reorganization
GO:0097435	0.621	supramolecular fiber organization
GO:0050896	0.387	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.994	cell periphery
GO:0031012	0.975	extracellular matrix
GO:0043226	0.860	organelle
GO:0005576	0.844	extracellular region
GO:0062023	0.810	collagen-containing extracellular matrix
GO:0043227	0.794	membrane-bounded organelle
GO:0031982	0.349	vesicle
GO:1903561	0.341	extracellular vesicle
GO:0005615	0.327	extracellular space
GO:0070062	0.304	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]