StarFunc result for job id Q96RY5

User Input

>input (1269 residues)
MTVKLGDGGSGEDGLKKLGKRAADEESLEGEGAGGADAAEESSGTKRDEKTPRAGADGPP
APPGAPQAPSPPQGSPQDQHHFLRSSVRPQSKRPRKDPPSAVGSGNAGGSGPRGKGAEGG
GSSSGNVSGVAPAAPAGGSRSSSRNLGSSGGEKEEGKKVRRQWESWSTEDKNTFFEGLYE
HGKDFEAIQNNIALKYKKKGKPASMVKNKEQVRHFYYRTWHKITKYIDFDHVFSRGLKKS
SQELYGLICYGELRKKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKL
CDPDGLSDEEDQKPVRLPLKVPIELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIE
FLKQKWALHEVRVRKTLEERQLQDSCSAPMQEKVTLHLFPGENCTLTPLPGVARVVHSKA
FCTVHWQEGGRCKQSAKDAHVLPPAQILGIQSGQGTARGQVKCPRSGAEGKGVGRPPPAA
DALQSSGESSPESAPGEGAALSLSSPDAPDRPPPRHQDTGPCLEKTPAEGRDSPTREPGA
LPCACGQLPDLEDELSLLDPLPRYLKSCQDLIVPEQCRCADTRPGSEQPPLGGAASPEVL
APVSKEAADLAPTGPSPRPGPGLLLDVCTKDLADAPAEELQEKGSPAGPPPSQGQPAARP
PKEVPASRLAQQLREEGWNLQTSESLTLAEVYLMMGKPSKLQLEYDWLGPGRQDPRPGSL
PTALHKQRLLSCLLKLISTEVNPKLALEANTISTASVRPAQEEQSMTPPGKVVTVSSRSP
RCPRNQASLRSSKTFPPSSAPCSSGLRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPN
SRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSEN
QSHNVCSFSILSNSSVTGRGSFRPIQSSLTKAALSRPIVPKVLPPQATSHLASAIDLAAT
SAGILSGNPLPALDTEGLSGISPLSSDEVTGAISGQDSTGTHQDGDTLPTVGGSDPFVSI
PSRPEQEPVADSFQGSSVLSLSELPKAPLQNGLSIPLSSSESSSTRLSPPDVSALLDISL
PGPPEDALSQGEPATHISDSIIEIAISSGQYGEGVPLSPAKLNGSDSSKSLPSPSSSPQP
HWIASPTHDPQWYPSDSTDSSLSSLFASFISPEKSRKMLPTPIGTNSGTSLLGPSLLDGN
SRDSFVSRSLADVAEVVDSQLVCMMNENSIDYISRFNDLAQELSIAEPGRREALFDGGGG
GPAVSDLSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10071	0.042	0.036	2.074E-3	1580	0.177	0.142	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
2	AFDB:E1JI78	0.034	0.023	2.470E-3	2528	0.161	0.081	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
3	AFDB:O60885	0.044	0.042	3.504E-3	1362	0.143	0.133	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
4	AFDB:A0A2R8QMX9	0.043	0.042	4.688E-3	1443	0.140	0.123	A0A2R8QMX9.pdb.gz
5	AFDB:Q76L83	0.043	0.040	4.688E-3	1435	0.166	0.147	Q76L83.pdb.gz	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
6	AFDB:F1R5H6	0.038	0.037	5.584E-3	1444	0.164	0.144	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
7	AFDB:A0A0R4ICG0	0.046	0.043	5.919E-3	1387	0.157	0.143	A0A0R4ICG0.pdb.gz	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
8	AFDB:Q99700	0.042	0.040	6.274E-3	1313	0.170	0.165	Q99700.pdb.gz	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
9	AFDB:J3KRL7	0.061	0.061	1.060E-2	1267	0.161	0.161	J3KRL7.pdb.gz	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
10	AFDB:Q53TQ3	0.033	0.040	1.123E-2	1027	0.105	0.130	Q53TQ3.pdb.gz	IN80D_HUMAN INO80 complex subunit D OS=Homo sapiens OX=9606 GN=INO80D PE=1 SV=3
11	PDB:5k1aF	0.044	0.081	1.343E-1	600	0.014	0.030	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
12	PDB:1oqyA	0.027	0.071	3.831E-1	363	0.028	0.096	1oqyA.pdb.gz
13	PDB:5azhA	0.042	0.352	3.831E-1	127	0.011	0.110	5azhA.pdb.gz
14	PDB:7np7D4	0.035	0.098	3.831E-1	415	0.007	0.022	7np7D4.pdb.gz
15	PDB:1wz0A	0.030	0.310	6.106E-1	104	0.007	0.087	1wz0A.pdb.gz
16	PDB:6mdhA	0.035	0.244	6.860E-1	149	0.013	0.114	6mdhA.pdb.gz
17	PDB:7z6hD	0.036	0.114	8.170E-1	324	0.009	0.034	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
18	PDB:3udcA	0.041	0.119	8.660E-1	267	0.026	0.124	3udcA.pdb.gz
19	PDB:4czzB	0.036	0.322	1.093	133	0.012	0.113	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
20	PDB:6yvaC	0.034	0.225	1.093	155	0.009	0.077	6yvaC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76906	2.53e-46	183	982	0.077	0.100	CRM_DROME Protein cramped OS=Drosophila melanogaster OX=7227 GN=crm PE=1 SV=2
2	Q8LJT8	4.76e-07	56.6	743	0.020	0.034	TKI1_ARATH TSL-kinase interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=TKI1 PE=1 SV=2
3	Q9QY06	4.6	34.3	2114	0.022	0.013	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
4	O55207	5.2	33.9	1496	0.019	0.016	SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus OX=10116 GN=Synj2 PE=1 SV=2
5	Q9VY98	7.2	33.5	789	0.028	0.044	Q9VY98_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Mrgn1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	1.1e+02	14.5	Myb-like DNA-binding domain
2	PF15963 Myb_DNA-bind_7	9.3	17.5	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380559

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000473474	0.812	Short chain dehydrogenase/reductase family 42E, member 2
2	9606.ENSP00000293922	0.773	Pentraxin-4
3	9606.ENSP00000436848	0.752	LBH domain-containing protein 1
4	9606.ENSP00000262319	0.741	Telomere length regulation protein TEL2 homolog
5	9606.ENSP00000308022	0.739	Transcriptional adapter 2-beta
6	9606.ENSP00000296597	0.737	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
7	9606.ENSP00000226021	0.668	Voltage-dependent calcium channel gamma-1 subunit
8	9606.ENSP00000357315	0.662	GON-4-like protein
9	9606.ENSP00000301067	0.658	Histone-lysine N-methyltransferase 2D
10	9606.ENSP00000437738	0.657	Splicing factor, suppressor of white-apricot homolog
11	9606.ENSP00000248098	0.646	Jupiter microtubule associated homolog 2
12	9606.ENSP00000317257	0.645	Copine-1
13	9606.ENSP00000401115	0.636	SS18-like protein 2
14	9606.ENSP00000380877	0.621	Activating signal cointegrator 1 complex subunit 2
15	9606.ENSP00000254227	0.604	Nuclear receptor subfamily 0 group B member 2
16	9606.ENSP00000414670	0.595	Leiomodin-3
17	9606.ENSP00000383145	0.586	Protein SFI1 homolog
18	9606.ENSP00000349325	0.573	Probable phospholipid-transporting ATPase VA
19	9606.ENSP00000393795	0.564	Zinc finger protein 512B
20	9606.ENSP00000230640	0.557	Superkiller viralicidic activity 2-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.665	heterocyclic compound binding
GO:0097159	0.648	organic cyclic compound binding
GO:0003676	0.596	nucleic acid binding
GO:0003682	0.446	chromatin binding
GO:0003824	0.426	catalytic activity
GO:0003677	0.411	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.970	metabolic process
GO:0071704	0.946	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0043170	0.903	macromolecule metabolic process
GO:0006807	0.874	nitrogen compound metabolic process
GO:0009987	0.859	cellular process
GO:0065007	0.808	biological regulation
GO:0050794	0.761	regulation of cellular process
GO:0019222	0.417	regulation of metabolic process
GO:0060255	0.381	regulation of macromolecule metabolic process
GO:0044237	0.378	cellular metabolic process
GO:0048518	0.369	positive regulation of biological process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0051171	0.312	regulation of nitrogen compound metabolic process
GO:0080090	0.308	regulation of primary metabolic process
GO:1901564	0.301	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.687	cytoplasm
GO:0032991	0.361	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]