StarFunc result for job id Q96RY7

User Input

>input (1462 residues)
MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVER
PFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWSPSGNCLLS
GDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIFRLPPPGEDLVQLAKAAVSGDEKA
LDMFNWKKSSSGSLLKMGSHEGLLFFVSLMDGTVHYVDEKGKTTQVVSADSTIQMLFYME
KREALVVVTENLRLSLYTVPPEGKAEEVMKVKLSGKTGRRADIALIEGSLLVMAVGEAAL
RFWDIERGENYILSPDEKFGFEKGENMNCVCYCKVKGLLAAGTDRGRVAMWRKVPDFLGS
PGAEGKDRWALQTPTELQGNITQIQWGSRKNLLAVNSVISVAILSERAMSSHFHQQVAAM
QVSPSLLNVCFLSTGVAHSLRTDMHISGVFATKDAVAVWNGRQVAIFELSGAAIRSAGTF
LCETPVLAMHEENVYTVESNRVQVRTWQGTVKQLLLFSETEGNPCFLDICGNFLVVGTDL
AHFKSFDLSRREAKAHCSCRSLAELVPGVGGIASLRCSSSGSTISILPSKADNSPDSKIC
FYDVEMDTVTVFDFKTGQIDRRETLSFNEQETNKSHLFVDEGLKNYVPVNHFWDQSEPRL
FVCEAVQETPRSQPQSANGQPQDGRAGPAADVLILSFFISEEHGFLLHESFPRPATSHSL
LGMEVPYYYFTRKPEEADREDEVEPGCHHIPQMVSRRPLRDFVGLEDCDKATRDAMLHFS
FFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAE
QEPELEARVAVLATQLGMLEDAEQLYRKCKRHDLLNKFYQAAGRWQEALQVAEHHDRVHL
RSTYHRYAGHLEASADCSRALSYYEKSDTHRFEVPRMLSEDLPSLELYVNKMKDKTLWRW
WAQYLESQGEMDAALHYYELARDHFSLVRIHCFQGNVQKAAQIANETGNLAASYHLARQY
ESQEEVGQAVHFYTRAQAFKNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGVQ
MDRAVMLYHKAGHFSKALELAFATQQFVALQLIAEDLDETSDPALLARCSDFFIEHSQYE
RAVELLLAARKYQEALQLCLGQNMSITEEMAEKMTVAKDSSDLPEESRRELLEQIADCCM
RQGSYHLATKKYTQAGNKLKAMRALLKSGDTEKITFFASVSRQKEIYIMAANYLQSLDWR
KEPEIMKNIIGFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLAKAKAK
SPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYG
FLVEHYVRKEEYQTAYRFLEEMRRRLPLANMSYYVSPQAVDAVHRGLGLPLPRTVPEQVR
HNSMEDARELDEEVVEEADDDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY46	0.664	0.663	0.000	1464	0.817	0.816	E9PY46.pdb.gz	IF140_MOUSE Intraflagellar transport protein 140 homolog OS=Mus musculus OX=10090 GN=Ift140 PE=1 SV=1
2	AFDB:Q96RY7	1.000	1.000	0.000	1462	1.000	1.000	Q96RY7.pdb.gz	IF140_HUMAN Intraflagellar transport protein 140 homolog OS=Homo sapiens OX=9606 GN=IFT140 PE=1 SV=1
3	AFDB:Q7KTZ4	0.534	0.520	6.465E-92	1503	0.341	0.331	Q7KTZ4.pdb.gz	Q7KTZ4_DROME Reduced mechanoreceptor potential A, isoform B OS=Drosophila melanogaster OX=7227 GN=rempA PE=4 SV=1
4	AFDB:P90757	0.439	0.445	2.901E-90	1437	0.304	0.309	P90757.pdb.gz	P90757_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=che-11 PE=4 SV=5
5	AFDB:Q388F5	0.447	0.393	7.314E-75	1696	0.263	0.227	Q388F5.pdb.gz	Q388F5_TRYB2 Intraflagellar transport protein 140 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2260 PE=4 SV=1
6	AFDB:A1ZBM3	0.314	0.332	1.745E-37	1366	0.150	0.161	A1ZBM3.pdb.gz	A1ZBM3_DROME Outer segment 6 OS=Drosophila melanogaster OX=7227 GN=Oseg6 PE=4 SV=1
7	AFDB:G5ECZ4	0.261	0.272	2.663E-37	1383	0.147	0.155	G5ECZ4.pdb.gz	DYF2_CAEEL WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1
8	AFDB:Q8NEZ3	0.337	0.361	3.106E-37	1342	0.140	0.152	Q8NEZ3.pdb.gz	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
9	AFDB:Q3UGF1	0.331	0.356	1.287E-36	1341	0.134	0.146	Q3UGF1.pdb.gz	WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1
10	AFDB:A0A2R8RPA6	0.329	0.346	3.495E-36	1372	0.140	0.149	A0A2R8RPA6.pdb.gz
11	PDB:7mqaLQ	0.157	0.261	5.239E-17	830	0.086	0.152	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6qk7A	0.197	0.230	1.596E-16	1161	0.121	0.152	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:7mq8LR	0.182	0.327	2.016E-15	773	0.068	0.128	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LO	0.172	0.275	1.801E-14	848	0.077	0.132	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8LT	0.136	0.219	2.449E-14	869	0.077	0.130	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6lqsB1	0.176	0.289	2.645E-14	806	0.067	0.122	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:7mqaLO	0.166	0.277	3.884E-14	819	0.080	0.143	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7ajtUA	0.175	0.279	1.610E-13	834	0.066	0.115	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7ajuUL	0.158	0.274	1.877E-13	779	0.068	0.128	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7d5sBE	0.179	0.287	2.456E-13	865	0.073	0.123	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PY46	0.0	2515	1464	0.817	0.816	IF140_MOUSE Intraflagellar transport protein 140 homolog OS=Mus musculus OX=10090 GN=Ift140 PE=1 SV=1
2	P90757	0.0	764	1437	0.313	0.318	P90757_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=che-11 PE=4 SV=5
3	Q68K27	0.0	764	1384	0.334	0.353	Q68K27_CHLRE Intraflagellar transport particle protein 140 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT140 PE=1 SV=1
4	Q7KTZ4	0.0	807	1503	0.343	0.333	Q7KTZ4_DROME Reduced mechanoreceptor potential A, isoform B OS=Drosophila melanogaster OX=7227 GN=rempA PE=4 SV=1
5	Q91VU5	0.0	1060	606	0.350	0.843	Q91VU5_MOUSE Ift140 protein OS=Mus musculus OX=10090 GN=Ift140 PE=2 SV=1
6	Q96RY7	0.0	3056	1462	1.000	1.000	IF140_HUMAN Intraflagellar transport protein 140 homolog OS=Homo sapiens OX=9606 GN=IFT140 PE=1 SV=1
7	Q9VPR0	0.0	768	1458	0.328	0.329	Q9VPR0_DROME LP14662p OS=Drosophila melanogaster OX=7227 GN=rempA PE=2 SV=2
8	Q388F5	1.46e-60	232	1696	0.106	0.091	Q388F5_TRYB2 Intraflagellar transport protein 140 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2260 PE=4 SV=1
9	Q387M5	1.14e-08	62.4	1356	0.055	0.059	Q387M5_TRYB2 WD repeat-containing protein 19 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0880 PE=4 SV=1
10	Q9W040	1.63e-07	58.9	1754	0.079	0.066	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
11	G5ECZ4	3.67e-06	54.3	1383	0.083	0.088	DYF2_CAEEL WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1
12	Q38CC3	3.74e-05	51.2	1747	0.060	0.050	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
13	Q5RHH4	4.35e-05	50.8	1745	0.049	0.041	IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1
14	Q86Y33	7.93e-05	49.7	519	0.036	0.100	CD20B_HUMAN Cell division cycle protein 20 homolog B OS=Homo sapiens OX=9606 GN=CDC20B PE=1 SV=3
15	Q5DM57	4.39e-04	47.4	1755	0.049	0.040	IF172_CHLRE Intraflagellar transport protein 172 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT172 PE=1 SV=1
16	Q8NEZ3	0.001	46.2	1342	0.079	0.086	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
17	Q6VH22	0.005	43.9	1749	0.036	0.030	IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1
18	C8VF02	0.007	43.5	836	0.013	0.023	C8VF02_EMENI SepB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10635 PE=4 SV=1
19	U4PCM1	0.008	43.1	809	0.016	0.028	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
20	Q24044	0.009	42.7	526	0.052	0.144	Q24044_DROME FI02843p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.4e-06	38.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00637 Clathrin	0.014	26.7	Region in Clathrin and VPS
3	PF04053 Coatomer_WDAD	0.048	24.4	Coatomer WD associated region
4	PF01535 PPR	8.7	17.9	PPR repeat
5	PF13041 PPR_2	52	15.5	PPR repeat family
6	PF08450 SGL	2.9e+02	12.5	SMP-30/Gluconolactonase/LRE-like region
7	PF00400 WD40	79	15.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406012

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296266	0.999	Intraflagellar transport protein 122 homolog
2	9606.ENSP00000382717	0.999	WD repeat-containing protein 19
3	9606.ENSP00000243344	0.996	Tetratricopeptide repeat protein 21B
4	9606.ENSP00000238628	0.995	Intraflagellar transport proteins
5	9606.ENSP00000314444	0.995	WD repeat-containing protein 35
6	9606.ENSP00000312778	0.987	Intraflagellar transport protein 80 homolog
7	9606.ENSP00000393541	0.985	Intraflagellar transport protein 27 homolog
8	9606.ENSP00000323580	0.984	Intraflagellar transport protein 88 homolog
9	9606.ENSP00000242591	0.983	Intraflagellar transport protein 81 homolog
10	9606.ENSP00000260570	0.983	Intraflagellar transport protein 172 homolog
11	9606.ENSP00000464443	0.980	Intraflagellar transport protein 20 homolog
12	9606.ENSP00000362121	0.972	Intraflagellar transport protein 52 homolog
13	9606.ENSP00000264538	0.970	Intraflagellar transport protein 57 homolog
14	9606.ENSP00000362424	0.964	TRAF3-interacting protein 1
15	9606.ENSP00000264020	0.963	Intraflagellar transport proteins
16	9606.ENSP00000404122	0.963	Intraflagellar transport protein 74 homolog
17	9606.ENSP00000381167	0.957	Cytoplasmic dynein 2 heavy chain 1
18	9606.ENSP00000419279	0.957	Intraflagellar transport protein 56
19	9606.ENSP00000474032	0.946	Cytoplasmic dynein 2 light intermediate chain 1
20	9606.ENSP00000320359	0.940	Intraflagellar transport protein 22 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0042073	0.994	intraciliary transport
GO:0050789	0.980	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0070925	0.966	organelle assembly
GO:0060271	0.959	cilium assembly
GO:0008104	0.485	protein localization
GO:0032501	0.354	multicellular organismal process
GO:0044087	0.349	regulation of cellular component biogenesis
GO:0051128	0.341	regulation of cellular component organization
GO:0061512	0.335	protein localization to cilium
GO:1902115	0.334	regulation of organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005929	1.000	cilium
GO:0015630	0.998	microtubule cytoskeleton
GO:0005815	0.992	microtubule organizing center
GO:0030990	0.952	intraciliary transport particle
GO:0005737	0.936	cytoplasm
GO:0005813	0.912	centrosome
GO:0036064	0.799	ciliary basal body
GO:0097542	0.796	ciliary tip
GO:0005829	0.657	cytosol
GO:0030991	0.521	intraciliary transport particle A
GO:0097730	0.509	non-motile cilium
GO:0016020	0.361	membrane
GO:0097014	0.306	ciliary plasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]