StarFunc result for job id Q96S15

User Input

>input (790 residues)
MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFV
EKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHK
RTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFA
STFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTH
RAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVT
TGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYA
LAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLP
LMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLL
GDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGS
EADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVL
GERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCS
HCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP
AGCGHLCEYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A499FJD3	0.567	0.492	0.000	920	0.997	0.857	A0A499FJD3.pdb.gz	A0A499FJD3_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
2	AFDB:Q8CFJ9	0.536	0.536	0.000	790	0.954	0.954	Q8CFJ9.pdb.gz	WDR24_MOUSE GATOR2 complex protein WDR24 OS=Mus musculus OX=10090 GN=Wdr24 PE=1 SV=1
3	PDB:7uhyC	0.438	0.593	3.660E-92	578	0.730	0.998	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
4	PDB:3gfcA	0.361	0.819	1.908E-20	339	0.080	0.186	3gfcA.pdb.gz
5	PDB:6zrdA	0.338	0.631	2.614E-20	411	0.084	0.161	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
6	PDB:3w15A	0.343	0.790	3.397E-20	336	0.086	0.202	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
7	PDB:2ybaB	0.358	0.718	4.415E-20	382	0.080	0.165	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
8	AFDB:O00628	0.353	0.837	6.642E-20	323	0.087	0.214	O00628.pdb.gz	PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens OX=9606 GN=PEX7 PE=1 SV=1
9	PDB:3cfvB	0.358	0.703	9.198E-20	393	0.078	0.158	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
10	AFDB:P90916	0.360	0.666	3.374E-19	417	0.080	0.151	P90916.pdb.gz	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
11	AFDB:U4PCM1	0.347	0.339	5.699E-19	809	0.133	0.130	U4PCM1.pdb.gz	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
12	PDB:3jcmB	0.338	0.602	8.316E-19	429	0.078	0.145	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
13	AFDB:O22469	0.350	0.639	1.014E-18	424	0.075	0.139	O22469.pdb.gz	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
14	PDB:3dm0A	0.342	0.397	1.826E-18	675	0.087	0.102	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
15	AFDB:A0A1P8AW69	0.345	0.272	2.005E-18	1019	0.123	0.095	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
16	PDB:6s29C	0.342	0.666	7.924E-18	394	0.072	0.145	6s29C.pdb.gz
17	AFDB:P90917	0.354	0.663	1.324E-17	412	0.082	0.158	P90917.pdb.gz	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
18	PDB:5lcwR	0.343	0.680	1.486E-17	383	0.076	0.157	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
19	AFDB:Q6NS57	0.326	0.177	7.085E-17	1503	0.111	0.059	Q6NS57.pdb.gz	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
20	AFDB:Q4GZ31	0.322	0.182	4.438E-16	1443	0.203	0.111	Q4GZ31.pdb.gz	Q4GZ31_TRYB2 WD repeat protein mio zinc-ribbon like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1880 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISA1	0.0	1321	864	0.797	0.729	A0A3B3ISA1_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
2	A0A499FJD3	0.0	1326	920	0.867	0.745	A0A499FJD3_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
3	Q8CFJ9	0.0	1561	790	0.956	0.956	WDR24_MOUSE GATOR2 complex protein WDR24 OS=Mus musculus OX=10090 GN=Wdr24 PE=1 SV=1
4	Q96S15	0.0	1646	790	1.000	1.000	WDR24_HUMAN GATOR2 complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=2
5	Q9XZ25	2.40e-172	517	776	0.376	0.383	WDR24_DROME GATOR2 complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=1 SV=1
6	Q86BR7	8.98e-172	516	777	0.375	0.381	Q86BR7_DROME GATOR complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=3 SV=2
7	O14186	1.00e-45	178	846	0.257	0.240	YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F8.11 PE=4 SV=1
8	Q9XF57	6.27e-22	99.8	317	0.086	0.215	PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana OX=3702 GN=PEX7 PE=1 SV=2
9	Q9VSN7	9.53e-19	90.5	339	0.085	0.198	Q9VSN7_DROME Peroxin-7 OS=Drosophila melanogaster OX=7227 GN=Pex7 PE=3 SV=1
10	O00628	2.71e-17	85.9	323	0.077	0.189	PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens OX=9606 GN=PEX7 PE=1 SV=1
11	P97865	2.06e-16	83.2	318	0.075	0.186	PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus OX=10090 GN=Pex7 PE=1 SV=1
12	Q8R537	1.29e-15	80.9	318	0.073	0.182	PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus OX=10029 GN=PEX7 PE=1 SV=1
13	F4HTH8	2.21e-15	83.2	1181	0.087	0.058	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
14	A0A1P8AW69	7.22e-15	81.3	1019	0.065	0.050	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
15	F4KB17	2.86e-14	79.3	839	0.091	0.086	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
16	B4DJV5	5.06e-14	77.4	439	0.070	0.125	B4DJV5_HUMAN PWP1 homolog, endonuclein OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1
17	Q13610	6.74e-14	77.4	501	0.070	0.110	PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1
18	F4K3Y7	1.64e-13	76.6	657	0.086	0.104	F4K3Y7_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=2
19	Q08281	1.77e-13	77.0	1341	0.063	0.037	RTC1_YEAST Restriction of telomere capping protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTC1 PE=1 SV=2
20	Q6NLV4	1.81e-13	76.6	647	0.086	0.105	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	14	17.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	67	13.8	Neurobeachin beta propeller domain
3	PF00400 WD40	2.4e-12	58.3	WD domain, G-beta repeat
4	PF17120 zf-RING_16	1.9	19.5	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339881	0.999	GATOR complex protein MIOS
2	9606.ENSP00000382779	0.999	Nucleoporin SEH1
3	9606.ENSP00000483814	0.998	GATOR complex protein NPRL3
4	9606.ENSP00000232501	0.997	GATOR complex protein NPRL2
5	9606.ENSP00000373312	0.997	Protein SEC13 homolog
6	9606.ENSP00000383105	0.997	GATOR complex protein DEPDC5
7	9606.ENSP00000253063	0.992	Sestrin-2
8	9606.ENSP00000262144	0.992	GATOR complex protein WDR59
9	9606.ENSP00000262850	0.985	Ras-related GTP-binding protein B
10	9606.ENSP00000362092	0.981	Ras-related GTP-binding protein C
11	9606.ENSP00000369899	0.980	Ras-related GTP-binding protein A
12	9606.ENSP00000262187	0.973	GTP-binding protein Rheb
13	9606.ENSP00000358423	0.972	Ras-related GTP-binding protein D
14	9606.ENSP00000384183	0.968	Cytosolic arginine sensor for mTORC1 subunit 1
15	9606.ENSP00000278671	0.960	Ragulator complex protein LAMTOR1
16	9606.ENSP00000307272	0.960	Regulatory-associated protein of mTOR
17	9606.ENSP00000343118	0.954	Ragulator complex protein LAMTOR4
18	9606.ENSP00000424183	0.947	Ragulator complex protein LAMTOR3
19	9606.ENSP00000256644	0.944	Ragulator complex protein LAMTOR5
20	9606.ENSP00000457168	0.943	KICSTOR complex protein SZT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.991	positive regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.976	response to stimulus
GO:0031323	0.971	regulation of cellular metabolic process
GO:0032006	0.967	regulation of TOR signaling
GO:0051716	0.933	cellular response to stimulus
GO:0009267	0.854	cellular response to starvation
GO:1990928	0.823	response to amino acid starvation
GO:0034198	0.781	cellular response to amino acid starvation
GO:0009967	0.760	positive regulation of signal transduction
GO:0032008	0.718	positive regulation of TOR signaling
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0065009	0.630	regulation of molecular function
GO:0009894	0.617	regulation of catabolic process
GO:0050790	0.598	regulation of catalytic activity
GO:0019220	0.567	regulation of phosphate metabolic process
GO:0042325	0.560	regulation of phosphorylation
GO:0009893	0.544	positive regulation of metabolic process
GO:0051338	0.496	regulation of transferase activity
GO:0031329	0.464	regulation of cellular catabolic process
GO:0031325	0.464	positive regulation of cellular metabolic process
GO:0051171	0.424	regulation of nitrogen compound metabolic process
GO:0080090	0.423	regulation of primary metabolic process
GO:0051246	0.408	regulation of protein metabolic process
GO:0010506	0.389	regulation of autophagy
GO:0001932	0.347	regulation of protein phosphorylation
GO:0043549	0.343	regulation of kinase activity
GO:0051247	0.340	positive regulation of protein metabolic process
GO:0031401	0.306	positive regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0098588	0.997	bounding membrane of organelle
GO:0005764	0.997	lysosome
GO:0032991	0.996	protein-containing complex
GO:0035859	0.969	Seh1-associated complex
GO:0005765	0.965	lysosomal membrane
GO:0061700	0.604	GATOR2 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]