StarFunc result for job id Q96S16

User Input

>input (264 residues)
MAPASRLLALWALAAVALPGSGAEGDGGWRPGGPGAVAEEERCTVERRADLTYAEFVQQY
AFVRPVILQGLTDNSRFRALCSRDRLLASFGDRVVRLSTANTYSYHKVDLPFQEYVEQLL
HPQDPTSLGNDTLYFFGDNNFTEWASLFRHYSPPPFGLLGTAPAYSFGIAGAGSGVPFHW
HGPGYSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLRDTYPALPPSARPLECTIRAGEVL
YFPDRWWHATLNLDTSVFISTFLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96S16	1.000	1.000	3.009E-59	264	1.000	1.000	Q96S16.pdb.gz	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
2	AFDB:Q67XX3	0.711	0.384	1.106E-15	502	0.223	0.118	Q67XX3.pdb.gz	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
3	AFDB:B2WTI4	0.690	0.517	2.011E-15	361	0.242	0.177	B2WTI4.pdb.gz	B2WTI4_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
4	AFDB:K7EJU9	0.692	0.478	4.119E-15	395	0.239	0.159	K7EJU9.pdb.gz	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
5	AFDB:Q9GYI4	0.698	0.477	4.641E-15	400	0.212	0.140	Q9GYI4.pdb.gz	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
6	AFDB:Q6PFM0	0.691	0.466	5.894E-15	403	0.227	0.149	Q6PFM0.pdb.gz	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
7	AFDB:Q6NYC1	0.686	0.465	1.009E-14	403	0.227	0.149	Q6NYC1.pdb.gz	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
8	AFDB:Q8RWR1	0.649	0.415	1.360E-14	429	0.186	0.114	Q8RWR1.pdb.gz	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
9	AFDB:A0A0S2Z5T1	0.651	0.428	2.067E-14	416	0.220	0.139	A0A0S2Z5T1.pdb.gz	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
10	AFDB:Q6Q4H1	0.696	0.490	2.194E-14	385	0.212	0.145	Q6Q4H1.pdb.gz	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1
11	PDB:3al5B	0.641	0.553	2.847E-13	311	0.163	0.138	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:4qszA	0.630	0.259	1.228E-11	686	0.201	0.077	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
13	PDB:5nfnB	0.621	0.524	2.669E-11	318	0.205	0.170	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
14	PDB:3al5C	0.603	0.565	4.055E-11	284	0.170	0.158	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
15	PDB:4b7eA	0.482	0.381	3.282E-10	349	0.205	0.155	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
16	PDB:7yxgA	0.484	0.414	3.282E-10	313	0.201	0.169	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
17	PDB:4cclB	0.478	0.360	6.910E-9	372	0.178	0.126	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:4bxfA	0.520	0.345	7.103E-8	425	0.133	0.082	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4bu2A	0.459	0.333	7.751E-7	379	0.121	0.084	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:2vqaA	0.291	0.221	7.267E-5	356	0.083	0.062	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96S16	0.0	540	264	1.000	1.000	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
2	Q67XX3	8.64e-14	72.8	502	0.254	0.133	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
3	Q6Q4H1	2.38e-12	68.2	385	0.261	0.179	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1
4	Q6PFM0	2.67e-12	68.2	403	0.258	0.169	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
5	K7EJU9	1.16e-10	63.2	395	0.258	0.172	K7EJU9_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
6	Q6NYC1	1.75e-10	62.8	403	0.258	0.169	JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
7	B2WTI4	2.04e-10	62.4	361	0.258	0.188	B2WTI4_HUMAN Jumonji domain containing 6, arginine demethylase and lysine hydroxylase OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1
8	Q9ERI5	2.94e-10	62.0	403	0.258	0.169	JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus OX=10090 GN=Jmjd6 PE=1 SV=2
9	Q9GYI4	6.37e-10	61.2	400	0.235	0.155	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
10	Q9VD28	1.79e-09	59.7	408	0.227	0.147	JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster OX=7227 GN=PSR PE=2 SV=1
11	Q386V9	7.20e-07	52.0	550	0.170	0.082	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1
12	Q9CXT6	7.85e-07	52.0	414	0.186	0.118	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
13	Q96EW2	1.35e-06	51.2	488	0.148	0.080	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
14	Q9H9V9	1.65e-06	50.8	463	0.144	0.082	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
15	Q8RWR1	1.85e-06	50.8	429	0.223	0.138	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
16	Q67ZB6	1.06e-05	48.5	462	0.220	0.126	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
17	A0A0S2Z5T1	1.32e-05	48.1	416	0.193	0.123	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
18	Q8N371	1.32e-05	48.1	416	0.193	0.123	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
19	Q27GT3	6.28e-05	45.8	284	0.174	0.162	Q27GT3_CAEEL JmjC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=1
20	Q9VB06	4.46e-04	43.5	398	0.114	0.075	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00190 Cupin_1	2.7e+02	12.6	Cupin
2	PF07883 Cupin_2	3.3e+02	12.4	Cupin domain
3	PF13621 Cupin_8	4.2e-08	44.9	Cupin-like domain
4	PF07345 DUF1476	4.8e+02	12.5	ATPase inhibitor subunit zeta
5	PF02373 JmjC	5.8	18.8	JmjC domain, hydroxylase
6	PF08007 JmjC_2	0.026	25.5	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380467	0.827	JmjC domain-containing protein 7
2	9606.ENSP00000346627	0.719	tRNA wybutosine-synthesizing protein 5
3	9606.ENSP00000293883	0.694	GATOR complex protein WDR24
4	9606.ENSP00000477507	0.654	Ribosomal oxygenase 1
5	9606.ENSP00000380692	0.616	Lysine-specific demethylase 7A
6	9606.ENSP00000285947	0.604	SET domain containing 9
7	9606.ENSP00000328251	0.595	Ribosomal oxygenase 2
8	9606.ENSP00000299163	0.546	Hypoxia-inducible factor 1-alpha inhibitor
9	9606.ENSP00000263102	0.542	Coiled-coil domain containing 6
10	9606.ENSP00000341280	0.537	Protein Jumonji
11	9606.ENSP00000482285	0.537	Intermediate filament family orphan 1
12	9606.ENSP00000382163	0.534	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
13	9606.ENSP00000326563	0.531	Lysine-specific demethylase 3B
14	9606.ENSP00000454380	0.524	Protein FAM173A
15	9606.ENSP00000366271	0.515	Lysine-specific demethylase 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.960	catalytic activity
GO:0051213	0.948	dioxygenase activity
GO:0016705	0.945	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016706	0.944	2-oxoglutarate-dependent dioxygenase activity
GO:0140096	0.892	catalytic activity, acting on a protein
GO:0046872	0.857	metal ion binding
GO:0046914	0.845	transition metal ion binding
GO:0032452	0.477	histone demethylase activity
GO:0005506	0.378	iron ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.985	positive regulation of cellular process
GO:0023051	0.983	regulation of signaling
GO:0010646	0.983	regulation of cell communication
GO:1901342	0.983	regulation of vasculature development
GO:1903578	0.980	regulation of ATP metabolic process
GO:0006109	0.979	regulation of carbohydrate metabolic process
GO:0048583	0.969	regulation of response to stimulus
GO:0009966	0.961	regulation of signal transduction
GO:0006110	0.925	regulation of glycolytic process
GO:1902531	0.908	regulation of intracellular signal transduction
GO:0009967	0.582	positive regulation of signal transduction
GO:0022603	0.570	regulation of anatomical structure morphogenesis
GO:1903670	0.564	regulation of sprouting angiogenesis
GO:1902533	0.554	positive regulation of intracellular signal transduction
GO:0065009	0.452	regulation of molecular function
GO:0009987	0.399	cellular process
GO:0043123	0.380	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045766	0.379	positive regulation of angiogenesis
GO:0051338	0.374	regulation of transferase activity
GO:0071704	0.361	organic substance metabolic process
GO:0044238	0.356	primary metabolic process
GO:0006807	0.335	nitrogen compound metabolic process
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	1.000	intracellular organelle lumen
GO:0005634	1.000	nucleus
GO:0031981	0.974	nuclear lumen
GO:0012505	0.969	endomembrane system
GO:0005783	0.937	endoplasmic reticulum
GO:0005654	0.930	nucleoplasm
GO:0005788	0.853	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	0.945	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.11.-	0.944	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]