StarFunc result for job id Q96S38

User Input

>input (1066 residues)
MTSYRERSADLARFYTVTEPQRHPRGYTVYKVTARVVSRRNPEDVQEIIVWKRYSDFKKL
HKELWQIHKNLFRHSELFPPFAKGIVFGRFDETVIEERRQCAEDLLQFSANIPALYNSKQ
LEDFFKGGIINDSSELIGPAEAHSDSLIDTFPECSTEGFSSDSDLVSLTVDVDSLAELDD
GMASNQNSPIRTFGLNLSSDSSALGAVASDSEQSKTEEERESRSLFPGSLKPKLGKRDYL
EKAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQGESSPTRREAVKRRTAEYLMRA
ESISSLYGKPQLDDVSQPPGSLSSRPLWNLRSPAEELKAFRVLGVIDKVLLVMDTRTEQT
FILKGLRKSSEYSRNRKTIIPRCVPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFL
NRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSS
QDDSNQEDDGQDSSPKWPDSGSSSEEECTTSYLTLCNEYGQEKIEPGSLNEEPFMKTEGN
GVDTKAIKSFPAHLAADSDSPSTQLRAHELKFFPNDDPEAVSSPRTSDSLSRSKNSPMEF
FRIDSKDSASELLGLDFGEKLYSLKSEPLKPFFTLPDGDSASRSFNTSESKVEFKAQDTI
SRGSDDSVPVISFKDAAFDDVSGTDEGRPDLLVNLPGELESTREAAAMGPTKFTQTNIGI
IENKLLEAPDVLCLRLSTEQCQAHEEKGIEELSDPSGPKSYSITEKHYAQEDPRMLFVAA
VDHSSSGDMSLLPSSDPKFQGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKT
EEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFY
IPEGCIQRWAAEMVVALDALHREGIVCRDLNPNNILLNDRGHIQLTYFSRWSEVEDSCDS
DAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECV
SEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BLK9	0.335	0.337	0.000	1056	0.782	0.790	Q8BLK9.pdb.gz	KS6C1_MOUSE Ribosomal protein S6 kinase delta-1 OS=Mus musculus OX=10090 GN=Rps6kc1 PE=1 SV=2
2	AFDB:Q96S38	1.000	1.000	0.000	1066	1.000	1.000	Q96S38.pdb.gz	KS6C1_HUMAN Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=2
3	PDB:4yhjA	0.138	0.286	9.369E-10	501	0.053	0.112	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
4	PDB:3pvuA	0.133	0.228	2.609E-9	609	0.052	0.090	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
5	PDB:6pjxA	0.138	0.265	2.753E-9	543	0.046	0.090	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
6	PDB:6hhgA	0.136	0.362	3.415E-9	386	0.051	0.140	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
7	PDB:3uzsA	0.129	0.221	4.237E-9	609	0.051	0.089	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
8	PDB:6s9wA	0.141	0.352	4.237E-9	411	0.051	0.131	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
9	PDB:4mk0A	0.144	0.238	6.179E-9	631	0.051	0.086	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	PDB:5x3fB	0.138	0.401	6.882E-9	349	0.046	0.140	5x3fB.pdb.gz
11	PDB:6byrA	0.135	0.344	2.134E-8	405	0.045	0.119	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:5kcvA	0.134	0.388	2.509E-8	353	0.051	0.153	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
13	AFDB:B2BJC0	0.145	0.144	2.099E-7	1078	0.145	0.144	B2BJC0.pdb.gz	B2BJC0_DANRE Lats2-2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
14	AFDB:P18161	0.122	0.114	8.075E-7	1155	0.116	0.107	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
15	AFDB:Q8WYQ9	0.097	0.107	2.019E-6	949	0.114	0.129	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
16	AFDB:A2AAY5	0.097	0.112	3.033E-4	908	0.122	0.143	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
17	AFDB:O15061	0.046	0.040	3.971E-4	1565	0.127	0.086	O15061.pdb.gz	SYNEM_HUMAN Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=3
18	AFDB:Q8CEE6	0.125	0.097	5.487E-4	1383	0.143	0.110	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
19	AFDB:B4UN32	0.045	0.041	6.450E-4	1208	0.106	0.094	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
20	AFDB:Q9VZZ9	0.042	0.049	2.228E-3	878	0.119	0.145	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X1U5	0.0	1236	601	0.564	1.000	A0A087X1U5_HUMAN Ribosomal protein S6 kinase C1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=1
2	F5H7T0	0.0	1728	854	0.801	1.000	F5H7T0_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=1
3	F6RJM5	0.0	1808	885	0.830	1.000	F6RJM5_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=1
4	Q8BLK9	0.0	1645	1056	0.784	0.792	KS6C1_MOUSE Ribosomal protein S6 kinase delta-1 OS=Mus musculus OX=10090 GN=Rps6kc1 PE=1 SV=2
5	Q96S38	0.0	2185	1066	1.000	1.000	KS6C1_HUMAN Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=2
6	E5KQS5	7.66e-45	167	342	0.069	0.216	E5KQS5_HUMAN HCG2044837 OS=Homo sapiens OX=9606 GN=hCG_2044837 PE=4 SV=1
7	Q9NRS6	7.66e-45	167	342	0.069	0.216	SNX15_HUMAN Sorting nexin-15 OS=Homo sapiens OX=9606 GN=SNX15 PE=1 SV=1
8	Q9WUT3	8.21e-32	135	733	0.068	0.100	KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus OX=10090 GN=Rps6ka2 PE=1 SV=1
9	Q15349	2.93e-31	134	733	0.066	0.095	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
10	Q9PTN1	2.47e-30	131	737	0.066	0.095	Q9PTN1_XENLA Ribosomal protein S6 kinase OS=Xenopus laevis OX=8355 GN=rps6ka3.L PE=1 SV=1
11	A0A0R4ID09	9.61e-30	129	733	0.068	0.098	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
12	Q7ZVH8	1.00e-29	129	732	0.068	0.098	Q7ZVH8_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=rps6ka3 PE=1 SV=1
13	B4DG22	1.26e-29	129	711	0.066	0.098	B4DG22_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
14	B7ZB17	1.30e-29	129	712	0.066	0.098	B7ZB17_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
15	P18654	1.40e-29	129	740	0.066	0.095	KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus OX=10090 GN=Rps6ka3 PE=1 SV=2
16	A0A384MDW3	1.52e-29	129	740	0.066	0.095	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
17	P51812	1.52e-29	129	740	0.066	0.095	KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
18	F1R2A7	5.97e-29	126	709	0.065	0.097	F1R2A7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=zgc:158386 PE=1 SV=1
19	Q63531	1.79e-27	122	735	0.062	0.090	KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus OX=10116 GN=Rps6ka1 PE=1 SV=1
20	F1MNP4	1.97e-27	120	525	0.059	0.120	F1MNP4_BOVIN Ribosomal protein S6 kinase OS=Bos taurus OX=9913 GN=RPS6KB1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11919 DUF3437	2.3e+02	13.0	Domain of unknown function (DUF3437)
2	PF14531 Kinase-like	0.084	23.8	Kinase-like
3	PF04212 MIT	1.7e-12	58.5	MIT (microtubule interacting and transport) domain
4	PF00069 Pkinase	3.5e-25	100.4	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.3e-07	42.0	Protein tyrosine and serine/threonine kinase
6	PF00787 PX	2.5e-06	39.4	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313681	0.855	Sphingosine kinase 1
2	9606.ENSP00000260443	0.609	Probable ribosome biogenesis protein RLP24
3	9606.ENSP00000298510	0.594	Thioredoxin-dependent peroxide reductase, mitochondrial
4	9606.ENSP00000470381	0.516	Zinc finger protein 468
5	9606.ENSP00000418221	0.506	Ribosomal protein L7 like 1
6	9606.ENSP00000339958	0.504	Nischarin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0008289	0.393	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.992	cellular process
GO:0050789	0.980	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0051716	0.946	cellular response to stimulus
GO:0007154	0.918	cell communication
GO:0023052	0.882	signaling
GO:0007165	0.827	signal transduction
GO:0071704	0.601	organic substance metabolic process
GO:0044238	0.534	primary metabolic process
GO:0044237	0.532	cellular metabolic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0043170	0.514	macromolecule metabolic process
GO:1901564	0.424	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.997	endosome
GO:0000323	0.940	lytic vacuole
GO:0005769	0.929	early endosome
GO:0005764	0.879	lysosome
GO:0005829	0.706	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]