StarFunc result for job id Q96S42

User Input

>input (347 residues)
MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRS
LQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPD
TEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGEC
WPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHL
PDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLL
KRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96S42	1.000	1.000	5.156E-69	347	1.000	1.000	Q96S42.pdb.gz	NODAL_HUMAN Nodal homolog OS=Homo sapiens OX=9606 GN=NODAL PE=1 SV=2
2	AFDB:D3ZGK9	0.819	0.803	5.972E-54	354	0.804	0.788	D3ZGK9.pdb.gz	D3ZGK9_RAT Nodal growth differentiation factor OS=Rattus norvegicus OX=10116 GN=Nodal PE=3 SV=1
3	AFDB:F1QDT8	0.625	0.560	7.563E-28	392	0.366	0.324	F1QDT8.pdb.gz
4	AFDB:Q91620	0.553	0.483	2.495E-26	405	0.329	0.281	Q91620.pdb.gz	NOD2A_XENLA Nodal homolog 2-A OS=Xenopus laevis OX=8355 GN=nodal2-a PE=1 SV=1
5	AFDB:Q91619	0.602	0.521	1.117E-25	406	0.378	0.323	Q91619.pdb.gz	NODAL_XENLA Nodal homolog OS=Xenopus laevis OX=8355 GN=nodal PE=1 SV=1
6	AFDB:Q7ZZT5	0.333	0.292	1.149E-24	404	0.354	0.304	Q7ZZT5.pdb.gz	Q7ZZT5_DANRE Southpaw OS=Danio rerio OX=7955 GN=spaw PE=2 SV=1
7	AFDB:A0A0R4IZE5	0.526	0.380	5.433E-24	505	0.346	0.238	A0A0R4IZE5.pdb.gz
8	AFDB:G5EEL5	0.302	0.287	1.184E-19	365	0.251	0.238	G5EEL5.pdb.gz	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
9	AFDB:A0A0B5GTK3	0.296	0.267	1.521E-18	386	0.271	0.244	A0A0B5GTK3.pdb.gz
10	AFDB:P55105	0.295	0.258	2.506E-18	399	0.282	0.246	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
11	PDB:5ntuA	0.364	0.403	4.256E-11	308	0.187	0.211	5ntuA.pdb.gz
12	PDB:6umxA	0.311	0.363	5.314E-11	279	0.179	0.222	6umxA.pdb.gz
13	PDB:5hlyA	0.264	0.294	5.617E-11	299	0.199	0.231	5hlyA.pdb.gz
14	PDB:3rjrC	0.249	0.252	9.785E-11	343	0.205	0.207	3rjrC.pdb.gz
15	PDB:5vqfB	0.228	0.243	9.785E-11	320	0.179	0.194	5vqfB.pdb.gz
16	PDB:5nxsA	0.293	0.334	2.969E-10	290	0.179	0.214	5nxsA.pdb.gz
17	PDB:7y1rB	0.249	0.272	4.504E-9	308	0.156	0.175	7y1rB.pdb.gz
18	PDB:5ffoG	0.236	0.269	7.021E-9	297	0.170	0.199	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:5nxsB	0.240	0.299	1.486E-7	251	0.167	0.231	5nxsB.pdb.gz
20	PDB:6q2sA	0.179	0.504	1.261E-3	98	0.063	0.224	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZGK9	0.0	552	354	0.798	0.782	D3ZGK9_RAT Nodal growth differentiation factor OS=Rattus norvegicus OX=10116 GN=Nodal PE=3 SV=1
2	P43021	0.0	536	354	0.798	0.782	NODAL_MOUSE Nodal OS=Mus musculus OX=10090 GN=Nodal PE=2 SV=2
3	Q96S42	0.0	719	347	1.000	1.000	NODAL_HUMAN Nodal homolog OS=Homo sapiens OX=9606 GN=NODAL PE=1 SV=2
4	O13144	3.92e-55	187	392	0.352	0.311	O13144_DANRE Nodal-related 1 OS=Danio rerio OX=7955 GN=CHUNP6892 PE=1 SV=3
5	Q7ZZT5	1.65e-50	175	404	0.346	0.297	Q7ZZT5_DANRE Southpaw OS=Danio rerio OX=7955 GN=spaw PE=2 SV=1
6	P87358	1.56e-48	172	501	0.205	0.142	P87358_DANRE Cyclops OS=Danio rerio OX=7955 GN=Znr-1 PE=2 SV=2
7	Q91620	4.60e-47	166	405	0.334	0.286	NOD2A_XENLA Nodal homolog 2-A OS=Xenopus laevis OX=8355 GN=nodal2-a PE=1 SV=1
8	Q91619	1.42e-45	162	406	0.334	0.286	NODAL_XENLA Nodal homolog OS=Xenopus laevis OX=8355 GN=nodal PE=1 SV=1
9	G5EEL5	2.95e-38	142	365	0.259	0.247	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
10	Q8QGA0	2.81e-35	128	162	0.199	0.426	Q8QGA0_CHICK Nodal-related protein 1 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q9YGV1	7.57e-30	119	354	0.150	0.147	GDF3_XENLA Growth/differentiation factor 3 OS=Xenopus laevis OX=8355 GN=gdf3 PE=1 SV=1
12	Q9WV56	1.10e-29	119	428	0.288	0.234	GDF2_MOUSE Growth/differentiation factor 2 OS=Mus musculus OX=10090 GN=Gdf2 PE=1 SV=2
13	P43028	3.94e-29	118	454	0.271	0.207	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
14	P35621	4.43e-29	117	355	0.150	0.146	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
15	Q9UK05	2.65e-28	116	429	0.285	0.231	GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sapiens OX=9606 GN=GDF2 PE=1 SV=1
16	Q6KF10	1.80e-27	114	455	0.277	0.211	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
17	Q90751	5.77e-27	111	353	0.282	0.278	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
18	O93369	7.13e-27	112	411	0.265	0.224	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
19	Q70GM8	1.30e-26	110	383	0.277	0.251	Q70GM8_CHICK Bone morphogenetic protein-10 (Fragment) OS=Gallus gallus OX=9031 GN=BMP-10 PE=2 SV=1
20	Q06826	4.82e-26	109	408	0.285	0.243	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	0.71	21.1	TGF-beta propeptide
2	PF00019 TGF_beta	5.2e-27	106.1	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296145	0.964	Teratocarcinoma-derived growth factor 1
2	9606.ENSP00000340361	0.961	Activin receptor type-2B
3	9606.ENSP00000262160	0.960	Mothers against decapentaplegic homolog 2
4	9606.ENSP00000355785	0.956	Left-right determination factor 2
5	9606.ENSP00000272134	0.955	Left-right determination factor 1
6	9606.ENSP00000482760	0.940	Proprotein convertase subtilisin/kexin type 6
7	9606.ENSP00000332973	0.939	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000241416	0.924	Activin receptor type-2A
9	9606.ENSP00000259216	0.921	Cryptic protein
10	9606.ENSP00000442656	0.915	Activin receptor type-1B
11	9606.ENSP00000483552	0.914	Furin
12	9606.ENSP00000243349	0.902	Activin receptor type-1C
13	9606.ENSP00000370297	0.859	Cerberus
14	9606.ENSP00000287538	0.832	Zinc finger protein ZIC 3
15	9606.ENSP00000242208	0.822	Inhibin beta A chain
16	9606.ENSP00000266646	0.818	Inhibin beta E chain
17	9606.ENSP00000308716	0.818	Inhibin beta C chain
18	9606.ENSP00000295228	0.816	Inhibin beta B chain
19	9606.ENSP00000341551	0.800	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000323155	0.774	DAN domain family member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0033612	0.993	receptor serine/threonine kinase binding
GO:0070696	0.978	transmembrane receptor protein serine/threonine kinase binding
GO:0098772	0.928	molecular function regulator activity
GO:0140677	0.833	molecular function activator activity
GO:0030545	0.806	signaling receptor regulator activity
GO:0048018	0.798	receptor ligand activity
GO:0070698	0.305	type I activin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0007275	0.987	multicellular organism development
GO:0009987	0.984	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0050896	0.963	response to stimulus
GO:0048513	0.963	animal organ development
GO:0010468	0.959	regulation of gene expression
GO:0010604	0.952	positive regulation of macromolecule metabolic process
GO:0080090	0.951	regulation of primary metabolic process
GO:0051171	0.951	regulation of nitrogen compound metabolic process
GO:0048519	0.946	negative regulation of biological process
GO:0048522	0.941	positive regulation of cellular process
GO:0051252	0.937	regulation of RNA metabolic process
GO:0023056	0.930	positive regulation of signaling
GO:0010647	0.929	positive regulation of cell communication
GO:0048583	0.920	regulation of response to stimulus
GO:0007178	0.916	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051239	0.910	regulation of multicellular organismal process
GO:0050793	0.902	regulation of developmental process
GO:0048731	0.899	system development
GO:0048869	0.885	cellular developmental process
GO:0009653	0.884	anatomical structure morphogenesis
GO:0030154	0.884	cell differentiation
GO:0051094	0.884	positive regulation of developmental process
GO:0071363	0.881	cellular response to growth factor stimulus
GO:0009966	0.876	regulation of signal transduction
GO:0009888	0.873	tissue development
GO:0090092	0.859	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009790	0.841	embryo development
GO:0048598	0.824	embryonic morphogenesis
GO:0009889	0.823	regulation of biosynthetic process
GO:0007179	0.821	transforming growth factor beta receptor signaling pathway
GO:0051174	0.817	regulation of phosphorus metabolic process
GO:0010556	0.795	regulation of macromolecule biosynthetic process
GO:0031326	0.795	regulation of cellular biosynthetic process
GO:0048523	0.783	negative regulation of cellular process
GO:2001141	0.779	regulation of RNA biosynthetic process
GO:0042325	0.776	regulation of phosphorylation
GO:0045893	0.768	positive regulation of DNA-templated transcription
GO:0045595	0.745	regulation of cell differentiation
GO:0009967	0.745	positive regulation of signal transduction
GO:0051240	0.744	positive regulation of multicellular organismal process
GO:0048646	0.715	anatomical structure formation involved in morphogenesis
GO:0007498	0.703	mesoderm development
GO:0001704	0.698	formation of primary germ layer
GO:0042127	0.690	regulation of cell population proliferation
GO:0051246	0.675	regulation of protein metabolic process
GO:0003006	0.673	developmental process involved in reproduction
GO:0007492	0.663	endoderm development
GO:2000026	0.613	regulation of multicellular organismal development
GO:0006357	0.599	regulation of transcription by RNA polymerase II
GO:0044703	0.544	multi-organism reproductive process
GO:0044706	0.520	multi-multicellular organism process
GO:0007565	0.500	female pregnancy
GO:0065009	0.495	regulation of molecular function
GO:1901342	0.489	regulation of vasculature development
GO:0001890	0.423	placenta development
GO:0010605	0.418	negative regulation of macromolecule metabolic process
GO:0045944	0.403	positive regulation of transcription by RNA polymerase II
GO:0051093	0.321	negative regulation of developmental process
GO:0031399	0.317	regulation of protein modification process
GO:1904018	0.314	positive regulation of vasculature development
GO:0001932	0.309	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.996	cellular anatomical entity
GO:0005615	0.989	extracellular space
GO:0043233	0.525	organelle lumen
GO:0070013	0.474	intracellular organelle lumen
GO:0005634	0.359	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]