StarFunc result for job id Q96S52

User Input

>input (555 residues)
MAAAGAAATHLEVARGKRAALFFAAVAIVLGLPLWWKTTETYRASLPYSQISGLNALQLR
LMVPVTVVFTRESVPLDDQEKLPFTVVHEREIPLKYKMKIKCRFQKAYRRALDHEEEALS
SGSVQEAEAMLDEPQEQAEGSLTVYVISEHSSLLPQDMMSYIGPKRTAVVRGIMHREAFN
IIGRRIVQVAQAMSLTEDVLAAALADHLPEDKWSAEKRRPLKSSLGYEITFSLLNPDPKS
HDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDSASSSYYLDMHSL
PHVINPVESRLGSSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIM
VYNVDSKTYNASVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMT
WELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELA
SGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKI
FLETRKSWRKPEKTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PD26	0.992	0.992	0.000	555	0.917	0.917	Q6PD26.pdb.gz	PIGS_MOUSE GPI transamidase component PIG-S OS=Mus musculus OX=10090 GN=Pigs PE=1 SV=3
2	PDB:7w72S	0.871	0.904	5.113E-84	533	0.950	0.989	7w72S.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
3	AFDB:Q9VC10	0.784	0.810	3.909E-41	536	0.270	0.280	Q9VC10.pdb.gz	Q9VC10_DROME Phosphatidylinositol glycan anchor biosynthesis class S OS=Drosophila melanogaster OX=7227 GN=PIG-S PE=1 SV=2
4	AFDB:Q8W4D7	0.719	0.672	3.258E-34	599	0.247	0.229	Q8W4D7.pdb.gz	Q8W4D7_ARATH GPI transamidase component PIG-S-like protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.16 PE=1 SV=1
5	AFDB:Q10351	0.669	0.670	1.743E-33	554	0.220	0.220	Q10351.pdb.gz	PIGS_SCHPO GPI transamidase component PIG-S homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi17 PE=3 SV=1
6	AFDB:Q04080	0.664	0.686	3.684E-24	534	0.195	0.202	Q04080.pdb.gz	GPI17_YEAST GPI transamidase component GPI17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI17 PE=1 SV=1
7	AFDB:Q9LHA3	0.461	0.385	3.332E-14	687	0.142	0.115	Q9LHA3.pdb.gz	Q9LHA3_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At3g28720 PE=1 SV=1
8	AFDB:Q54W34	0.457	0.407	3.524E-14	641	0.128	0.111	Q54W34.pdb.gz	Q54W34_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279945 PE=4 SV=1
9	AFDB:F4JLQ2	0.451	0.329	3.862E-12	820	0.128	0.087	F4JLQ2.pdb.gz	F4JLQ2_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=DL4130C PE=1 SV=1
10	AFDB:F4KDI6	0.398	0.256	6.489E-8	945	0.141	0.083	F4KDI6.pdb.gz	F4KDI6_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g58100 PE=1 SV=1
11	AFDB:Q381L0	0.310	0.426	3.636E-6	377	0.090	0.133	Q381L0.pdb.gz	Q381L0_TRYB2 GPI transamidase component Tta1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7400 PE=4 SV=1
12	PDB:2x7mA	0.172	0.419	1.355E-2	180	0.054	0.167	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
13	PDB:7mi6A	0.072	0.028	2.120E-2	2419	0.067	0.015	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
14	PDB:3czpA	0.106	0.123	4.147E-2	466	0.112	0.133	3czpA.pdb.gz
15	PDB:3qbeA	0.098	0.133	5.187E-2	352	0.074	0.116	3qbeA.pdb.gz	Crystal structure of the 3-Dehydroquinate Synthase (aroB) from Mycobacterium tuberculosis
16	PDB:4lc9A	0.078	0.077	7.671E-2	567	0.049	0.048	4lc9A.pdb.gz	Structural basis for regulation of human glucokinase by glucokinase regulatory protein.
17	PDB:5b63C	0.085	0.085	1.135E-1	553	0.059	0.060	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
18	PDB:5sziA	0.076	0.178	1.269E-1	174	0.029	0.092	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
19	PDB:4uqqA	0.085	0.072	1.501E-1	693	0.079	0.063	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
20	PDB:2qagB	0.066	0.099	1.985E-1	246	0.027	0.061	2qagB.pdb.gz	Structural insight into filament formation by mammalian septins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PD26	0.0	982	555	0.919	0.919	PIGS_MOUSE GPI transamidase component PIG-S OS=Mus musculus OX=10090 GN=Pigs PE=1 SV=3
2	Q96S52	0.0	1134	555	1.000	1.000	PIGS_HUMAN GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3
3	Q9VC10	7.70e-44	165	536	0.270	0.280	Q9VC10_DROME Phosphatidylinositol glycan anchor biosynthesis class S OS=Drosophila melanogaster OX=7227 GN=PIG-S PE=1 SV=2
4	Q8W4D7	2.56e-41	159	599	0.259	0.240	Q8W4D7_ARATH GPI transamidase component PIG-S-like protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.16 PE=1 SV=1
5	Q10351	1.16e-40	157	554	0.252	0.253	PIGS_SCHPO GPI transamidase component PIG-S homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi17 PE=3 SV=1
6	Q04080	8.61e-18	89.0	534	0.238	0.247	GPI17_YEAST GPI transamidase component GPI17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI17 PE=1 SV=1
7	Q6GKV1	0.93	34.7	324	0.045	0.077	GET4_ARATH Protein GET4 OS=Arabidopsis thaliana OX=3702 GN=MDC12.19 PE=1 SV=1
8	P48996	1.0	34.7	1469	0.027	0.010	DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans OX=6239 GN=dpy-27 PE=1 SV=1
9	P57775	4.5	32.3	412	0.052	0.070	FBXW4_HUMAN F-box/WD repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=FBXW4 PE=1 SV=1
10	Q382K0	5.4	32.3	1281	0.034	0.015	Q382K0_TRYB2 AAA ATPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4940 PE=4 SV=1
11	O94536	7.5	32.0	1327	0.032	0.014	UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp12 PE=3 SV=1
12	Q8C0T0	8.0	31.6	401	0.036	0.050	XKR8_MOUSE XK-related protein 8 OS=Mus musculus OX=10090 GN=Xkr8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19470 DUF6007	2e+02	13.3	Family of unknown function (DUF6007)
2	PF03413 PepSY	6.4e+02	12.3	Peptidase propeptide and YPEB domain
3	PF10510 PIG-S	3.4e-141	483.3	Phosphatidylinositol-glycan biosynthesis class S protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279036	0.999	GPI transamidase component PIG-T
2	9606.ENSP00000359848	0.999	GPI-anchor transamidase
3	9606.ENSP00000347206	0.997	Glycosylphosphatidylinositol anchor attachment 1 protein
4	9606.ENSP00000217446	0.993	Phosphatidylinositol glycan anchor biosynthesis class U protein
5	9606.ENSP00000346809	0.962	GPI inositol-deacylase
6	9606.ENSP00000339328	0.900	Urokinase plasminogen activator surface receptor
7	9606.ENSP00000380793	0.830	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
8	9606.ENSP00000301732	0.817	ATP-binding cassette sub-family A member 3
9	9606.ENSP00000367880	0.745	GPI ethanolamine phosphate transferase 3
10	9606.ENSP00000281382	0.739	Phosphatidylinositol-glycan biosynthesis class F protein
11	9606.ENSP00000418875	0.671	Probable threonine protease PRSS50
12	9606.ENSP00000164305	0.628	GPI mannosyltransferase 3
13	9606.ENSP00000359683	0.621	Uncharacterized protein
14	9606.ENSP00000357069	0.610	GPI mannosyltransferase 1
15	9606.ENSP00000380019	0.602	Zinc finger protein 384
16	9606.ENSP00000369820	0.549	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
17	9606.ENSP00000376506	0.548	Programmed cell death protein 10
18	9606.ENSP00000308591	0.547	Galactose-3-O-sulfotransferase 3
19	9606.ENSP00000356702	0.545	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
20	9606.ENSP00000379008	0.527	Sodium/glucose cotransporter 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0019538	0.978	protein metabolic process
GO:1901576	0.949	organic substance biosynthetic process
GO:0006629	0.946	lipid metabolic process
GO:0044249	0.925	cellular biosynthetic process
GO:0044260	0.906	cellular macromolecule metabolic process
GO:1901135	0.905	carbohydrate derivative metabolic process
GO:0009059	0.905	macromolecule biosynthetic process
GO:1901566	0.905	organonitrogen compound biosynthetic process
GO:0036211	0.905	protein modification process
GO:0006650	0.905	glycerophospholipid metabolic process
GO:0006506	0.897	GPI anchor biosynthetic process
GO:0016255	0.453	attachment of GPI anchor to protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042765	0.999	GPI-anchor transamidase complex
GO:0070013	0.410	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]