StarFunc result for job id Q96S55

User Input

>input (665 residues)
MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGER
AKGPSPPGAKRRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGA
RLIPDFPVARSSSPGRKGSGKRPAAAAAAGSASPRSWDEAEAQEEEEAVGDGDGDGDADA
DGEDDPGHWDADAAEAATAFGASGGGRPHPRALAAEEIRQMLQGKPLADTMRPDTLQDYF
GQSKAVGQDTLLRSLLETNEIPSLILWGPPGCGKTTLAHIIASNSKKHSIRFVTLSATNA
KTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENP
SFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEP
AMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITEND
VKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLV
RFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNV
KACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFF
KQRRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96S55	1.000	1.000	0.000	665	1.000	1.000	Q96S55.pdb.gz	WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2
2	AFDB:F4HW65	0.297	0.185	1.064E-15	1116	0.162	0.097	F4HW65.pdb.gz	STIL1_ARATH Protein STICHEL-like 1 OS=Arabidopsis thaliana OX=3702 GN=At1g14460 PE=1 SV=1
3	PDB:8dqxC	0.315	0.593	1.105E-15	330	0.102	0.206	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
4	PDB:6vvoB	0.316	0.623	5.057E-15	316	0.098	0.206	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
5	PDB:7tfhB	0.344	0.650	1.326E-14	320	0.093	0.194	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
6	PDB:8dr0D	0.297	0.531	4.256E-14	344	0.092	0.177	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
7	PDB:7z6hG	0.302	0.595	8.310E-12	317	0.104	0.218	7z6hG.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
8	PDB:7z6hD	0.293	0.558	3.617E-11	324	0.098	0.201	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
9	AFDB:A0A024R1S2	0.316	0.368	5.783E-11	560	0.132	0.157	A0A024R1S2.pdb.gz
10	PDB:8dqwE	0.264	0.458	6.318E-11	354	0.089	0.167	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
11	PDB:1sxjE	0.255	0.495	1.352E-10	317	0.086	0.180	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
12	PDB:6blbA	0.280	0.566	1.352E-10	311	0.102	0.219	6blbA.pdb.gz	1.88 Angstrom Resolution Crystal Structure Holliday Junction ATP-dependent DNA Helicase (RuvB) from Pseudomonas aeruginosa in Complex with ADP.
13	PDB:3u5zB	0.258	0.485	3.728E-10	320	0.090	0.188	3u5zB.pdb.gz	How a DNA polymerase clamp loader opens a sliding clamp.
14	AFDB:Q9C0W2	0.263	0.158	2.542E-8	1201	0.135	0.075	Q9C0W2.pdb.gz	ATD22_SCHPO ATPase with bromodomain protein abo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo2 PE=3 SV=1
15	AFDB:O01836	0.153	0.145	2.464E-4	720	0.141	0.131	O01836.pdb.gz	GLH3_CAEEL ATP-dependent RNA helicase glh-3 OS=Caenorhabditis elegans OX=6239 GN=glh-3 PE=1 SV=1
16	AFDB:Q9JIK5	0.131	0.110	1.128E-3	851	0.117	0.092	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
17	AFDB:Q9C000	0.198	0.104	2.540E-3	1473	0.119	0.054	Q9C000.pdb.gz	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
18	AFDB:Q9SQV1	0.143	0.101	8.579E-3	1088	0.120	0.074	Q9SQV1.pdb.gz	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
19	AFDB:Q9VIQ9	0.188	0.075	1.354E-2	2197	0.138	0.042	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
20	AFDB:Q22308	0.140	0.098	2.248E-2	1022	0.089	0.058	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91XU0	0.0	1196	660	0.949	0.956	WRIP1_MOUSE ATPase WRNIP1 OS=Mus musculus OX=10090 GN=Wrnip1 PE=1 SV=2
2	Q96S55	0.0	1375	665	1.000	1.000	WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2
3	P40151	5.73e-120	371	587	0.314	0.356	WRIP1_YEAST DNA-dependent ATPase MGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGS1 PE=1 SV=2
4	P0AAZ4	7.60e-95	301	447	0.271	0.403	RARA_ECOLI Replication-associated recombination protein A OS=Escherichia coli (strain K12) OX=83333 GN=rarA PE=1 SV=1
5	Q72BF0	1.28e-83	271	411	0.263	0.426	Q72BF0_DESVH ATPase, AAA family OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1686 PE=1 SV=1
6	P38629	1.36e-11	68.6	340	0.098	0.191	RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC3 PE=1 SV=1
7	Q9A3G8	2.30e-09	62.0	346	0.063	0.121	RUVB_CAUVC Holliday junction branch migration complex subunit RuvB OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=ruvB PE=3 SV=1
8	Q383X4	4.43e-08	57.8	341	0.096	0.188	Q383X4_TRYB2 Replication factor C, subunit 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1310 PE=3 SV=1
9	Q97SR6	2.54e-07	55.5	332	0.071	0.142	RUVB_STRPN Holliday junction branch migration complex subunit RuvB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ruvB PE=1 SV=1
10	Q9CAQ8	3.36e-07	55.5	369	0.116	0.209	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
11	P0A812	5.27e-07	54.7	336	0.054	0.107	RUVB_ECOLI Holliday junction branch migration complex subunit RuvB OS=Escherichia coli (strain K12) OX=83333 GN=ruvB PE=1 SV=1
12	Q9CAM7	1.19e-06	53.5	333	0.081	0.162	RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana OX=3702 GN=RFC2 PE=1 SV=1
13	Q9WUK4	1.50e-06	53.1	349	0.090	0.172	RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus OX=10090 GN=Rfc2 PE=1 SV=1
14	P53034	1.79e-06	52.8	331	0.084	0.169	RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster OX=7227 GN=RfC4 PE=1 SV=1
15	P35250	2.34e-06	52.8	354	0.092	0.172	RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3
16	Q9AE09	3.75e-06	52.0	360	0.071	0.131	RUVB_CORGL Holliday junction branch migration complex subunit RuvB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=ruvB PE=3 SV=3
17	Q51426	2.00e-05	49.7	352	0.078	0.148	RUVB_PSEAE Holliday junction branch migration complex subunit RuvB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ruvB PE=1 SV=2
18	P53033	2.15e-05	49.7	359	0.086	0.159	RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus OX=9031 GN=RFC2 PE=2 SV=1
19	Q8IIJ8	2.19e-04	47.0	906	0.092	0.067	Q8IIJ8_PLAF7 Heat shock protein 101 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116800 PE=1 SV=1
20	P40339	2.65e-04	45.8	323	0.078	0.161	RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.7e-14	64.1	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	3.4e+02	12.4	AAA domain
3	PF13173 AAA_14	0.00034	32.1	AAA domain
4	PF13191 AAA_16	0.038	25.8	AAA ATPase domain
5	PF13238 AAA_18	5.2	19.0	AAA domain
6	PF13245 AAA_19	11	17.7	AAA domain
7	PF07724 AAA_2	0.45	22.1	AAA domain (Cdc48 subfamily)
8	PF13401 AAA_22	0.2	23.4	AAA domain
9	PF13479 AAA_24	2.7e+02	12.7	AAA domain
10	PF13521 AAA_28	2.3e+02	13.4	AAA domain
11	PF07726 AAA_3	1.7e+02	13.5	ATPase family associated with various cellular activities (AAA)
12	PF13604 AAA_30	1.1	20.4	AAA domain
13	PF13671 AAA_33	72	15.0	AAA domain
14	PF07728 AAA_5	0.0054	28.2	AAA domain (dynein-related subfamily)
15	PF12775 AAA_7	4.7	18.2	P-loop containing dynein motor region
16	PF16193 AAA_assoc_2	1.4e-20	84.7	AAA C-terminal domain
17	PF00005 ABC_tran	14	17.7	ABC transporter
18	PF00006 ATP-synt_ab	21	16.3	ATP synthase alpha/beta family, nucleotide-binding domain
19	PF01637 ATPase_2	0.37	22.2	ATPase domain predominantly from Archaea
20	PF00308 Bac_DnaA	3.6	18.9	Bacterial dnaA protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298139	0.972	Werner syndrome ATP-dependent helicase
2	9606.ENSP00000264926	0.888	E3 ubiquitin-protein ligase RAD18
3	9606.ENSP00000264159	0.792	DNA annealing helicase and endonuclease ZRANB3
4	9606.ENSP00000347232	0.763	Bloom syndrome protein
5	9606.ENSP00000480186	0.747	DNA polymerase delta subunit 2
6	9606.ENSP00000369335	0.730	F-box DNA helicase 1
7	9606.ENSP00000308944	0.726	Helicase-like transcription factor
8	9606.ENSP00000258428	0.699	DNA repair protein REV1
9	9606.ENSP00000265056	0.698	DNA replication licensing factor MCM2
10	9606.ENSP00000372088	0.691	DNA repair protein RAD51 homolog 1
11	9606.ENSP00000356475	0.679	E3 ubiquitin-protein ligase SHPRH
12	9606.ENSP00000314505	0.676	DNA helicase MCM9
13	9606.ENSP00000040738	0.674	Biorientation of chromosomes in cell division protein 1-like 1
14	9606.ENSP00000316176	0.657	Ubiquitin-conjugating enzyme E2 N
15	9606.ENSP00000406046	0.651	DNA polymerase delta catalytic subunit
16	9606.ENSP00000361310	0.649	DNA polymerase eta
17	9606.ENSP00000299575	0.634	ATM interactor
18	9606.ENSP00000313171	0.631	ATPase family AAA domain-containing protein 5
19	9606.ENSP00000307288	0.618	DNA replication licensing factor MCM7
20	9606.ENSP00000286398	0.612	Structural maintenance of chromosomes protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0016887	0.998	ATP hydrolysis activity
GO:1901363	0.703	heterocyclic compound binding
GO:0097159	0.703	organic cyclic compound binding
GO:0003676	0.666	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044260	0.996	cellular macromolecule metabolic process
GO:0090304	0.996	nucleic acid metabolic process
GO:0006259	0.993	DNA metabolic process
GO:0050896	0.989	response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0034654	0.980	nucleobase-containing compound biosynthetic process
GO:0033554	0.965	cellular response to stress
GO:0071897	0.962	DNA biosynthetic process
GO:0006281	0.955	DNA repair
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0000731	0.942	DNA synthesis involved in DNA repair
GO:0051052	0.939	regulation of DNA metabolic process
GO:0006275	0.926	regulation of DNA replication
GO:0090329	0.915	regulation of DNA-templated DNA replication
GO:0030174	0.801	regulation of DNA-templated DNA replication initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0016020	0.987	membrane
GO:0005737	0.985	cytoplasm
GO:0005694	0.955	chromosome
GO:0031981	0.906	nuclear lumen
GO:0005654	0.891	nucleoplasm
GO:0032991	0.769	protein-containing complex
GO:0098687	0.703	chromosomal region
GO:0000781	0.651	chromosome, telomeric region
GO:0048471	0.514	perinuclear region of cytoplasm
GO:0005829	0.364	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.998	ATP + H2O = ADP + H(+) + phosphate

[back to server]