StarFunc result for job id Q96S79

User Input

>input (203 residues)
MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDF
PPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSE
TPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCA
RCKHVHAALRFQGALRRNRCAIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SSG5	0.981	0.981	3.985E-43	203	0.990	0.990	Q5SSG5.pdb.gz	RSLAB_MOUSE Ras-like protein family member 10B OS=Mus musculus OX=10090 GN=Rasl10b PE=1 SV=1
2	AFDB:Q92737	0.775	0.775	4.775E-24	203	0.527	0.527	Q92737.pdb.gz	RSLAA_HUMAN Ras-like protein family member 10A OS=Homo sapiens OX=9606 GN=RASL10A PE=1 SV=1
3	AFDB:Q96HU8	0.754	0.768	6.731E-18	199	0.340	0.347	Q96HU8.pdb.gz	DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens OX=9606 GN=DIRAS2 PE=1 SV=1
4	AFDB:P08647	0.737	0.686	2.880E-17	219	0.246	0.228	P08647.pdb.gz	RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ras1 PE=1 SV=2
5	AFDB:B5X2X6	0.749	0.818	3.068E-17	185	0.276	0.303	B5X2X6.pdb.gz	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
6	AFDB:Q5XWT8	0.752	0.735	3.068E-17	208	0.276	0.269	Q5XWT8.pdb.gz	Q5XWT8_DANRE Ras-dva small GTPase OS=Danio rerio OX=7955 GN=im:7145881 PE=2 SV=1
7	AFDB:O94363	0.722	0.789	3.951E-17	185	0.261	0.286	O94363.pdb.gz	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
8	AFDB:P11233	0.743	0.733	5.420E-17	206	0.246	0.243	P11233.pdb.gz	RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1
9	AFDB:O95057	0.752	0.770	6.150E-17	198	0.286	0.293	O95057.pdb.gz	DIRA1_HUMAN GTP-binding protein Di-Ras1 OS=Homo sapiens OX=9606 GN=DIRAS1 PE=1 SV=1
10	AFDB:Q4V9D8	0.738	0.763	6.551E-17	196	0.246	0.255	Q4V9D8.pdb.gz	Q4V9D8_DANRE RAS-related OS=Danio rerio OX=7955 GN=fb23a02 PE=1 SV=1
11	PDB:6zizA	0.731	0.864	2.654E-15	170	0.236	0.282	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
12	PDB:6zqtA	0.737	0.857	8.281E-15	173	0.256	0.301	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
13	PDB:3t5gA	0.701	0.824	1.768E-14	171	0.251	0.298	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
14	PDB:5szjA	0.739	0.852	1.768E-14	175	0.202	0.234	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:6kykC	0.735	0.874	1.768E-14	169	0.256	0.308	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
16	PDB:2gf0B	0.714	0.824	5.516E-14	174	0.276	0.322	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
17	PDB:7e1tB	0.742	0.858	5.876E-14	174	0.192	0.224	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
18	PDB:7sd0B	0.735	0.849	6.259E-14	174	0.241	0.282	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
19	PDB:2f9mA	0.717	0.794	1.105E-13	182	0.202	0.225	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
20	PDB:2ew1A	0.666	0.783	1.833E-13	171	0.236	0.281	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96S79	3.81e-152	421	203	1.000	1.000	RSLAB_HUMAN Ras-like protein family member 10B OS=Homo sapiens OX=9606 GN=RASL10B PE=1 SV=1
2	Q5SSG5	8.14e-151	418	203	0.990	0.990	RSLAB_MOUSE Ras-like protein family member 10B OS=Mus musculus OX=10090 GN=Rasl10b PE=1 SV=1
3	Q92737	1.22e-68	210	203	0.537	0.537	RSLAA_HUMAN Ras-like protein family member 10A OS=Homo sapiens OX=9606 GN=RASL10A PE=1 SV=1
4	Q96HU8	3.51e-24	96.3	199	0.325	0.332	DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens OX=9606 GN=DIRAS2 PE=1 SV=1
5	B5X2X6	8.99e-22	89.7	185	0.291	0.319	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
6	B9EMH1	1.03e-21	89.7	185	0.291	0.319	B9EMH1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
7	Q6IQP4	2.10e-21	89.0	185	0.286	0.314	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
8	O94363	3.27e-21	88.2	185	0.281	0.308	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
9	C0H8F9	4.13e-21	88.2	184	0.286	0.315	C0H8F9_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
10	B5XFY1	4.74e-21	87.8	185	0.286	0.314	B5XFY1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
11	Q6TEN1	4.89e-21	87.8	184	0.286	0.315	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
12	Q9YH09	5.97e-21	88.2	206	0.271	0.267	RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis OX=8355 GN=ralb-a PE=1 SV=1
13	P11234	1.03e-20	87.4	206	0.266	0.262	RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1
14	B5XGC1	1.09e-20	87.0	184	0.281	0.310	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
15	P48555	1.12e-20	87.4	201	0.281	0.284	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
16	Q9N3F8	1.33e-20	87.4	213	0.286	0.272	Q9N3F8_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
17	P36860	1.37e-20	87.0	206	0.266	0.262	RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus OX=10116 GN=Ralb PE=2 SV=1
18	Q921J2	2.29e-20	86.3	184	0.256	0.283	RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus OX=10090 GN=Rheb PE=1 SV=1
19	Q62636	3.08e-20	85.9	184	0.281	0.310	RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus OX=10116 GN=Rap1b PE=1 SV=2
20	Q15382	3.25e-20	85.9	184	0.256	0.283	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	33	15.9	AAA domain
2	PF13191 AAA_16	21	16.9	AAA ATPase domain
3	PF00025 Arf	9.1	17.2	ADP-ribosylation factor family
4	PF05673 DUF815	3.8e+02	11.6	Protein of unknown function (DUF815)
5	PF01926 MMR_HSR1	14	17.2	50S ribosome-binding GTPase
6	PF00071 Ras	1.5e-20	84.9	Ras family
7	PF08477 Roc	0.0018	29.9	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373215	0.830	Calcium-dependent secretion activator 1
2	9606.ENSP00000365663	0.732	Natriuretic peptides A
3	9606.ENSP00000275954	0.647	Transmembrane protein 47
4	9606.ENSP00000296486	0.640	Ethanolamine-phosphate phospho-lyase
5	9606.ENSP00000364430	0.637	Transcription factor Sp5
6	9606.ENSP00000475168	0.634	Protein RER1
7	9606.ENSP00000336693	0.623	Belongs to the serine esterase family
8	9606.ENSP00000360561	0.620	Ectonucleoside triphosphate diphosphohydrolase 8
9	9606.ENSP00000303077	0.619	Putative aspartate aminotransferase, cytoplasmic 2
10	9606.ENSP00000241051	0.611	DEP domain containing 7
11	9606.ENSP00000222145	0.539	Ras-interacting protein 1
12	9606.ENSP00000307958	0.530	IQ domain-containing protein F1
13	9606.ENSP00000257017	0.524	Ras-related protein Rab-33A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0003924	0.510	GTPase activity
GO:0043167	0.355	ion binding
GO:0032561	0.354	guanyl ribonucleotide binding
GO:0043168	0.319	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0008217	0.922	regulation of blood pressure
GO:0048518	0.920	positive regulation of biological process
GO:0009987	0.911	cellular process
GO:0048522	0.905	positive regulation of cellular process
GO:0050886	0.874	endocrine process
GO:0003044	0.874	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0090087	0.820	regulation of peptide transport
GO:0023051	0.810	regulation of signaling
GO:0010646	0.810	regulation of cell communication
GO:0001990	0.800	regulation of systemic arterial blood pressure by hormone
GO:0010817	0.783	regulation of hormone levels
GO:0090277	0.741	positive regulation of peptide hormone secretion
GO:0050896	0.598	response to stimulus
GO:0051716	0.460	cellular response to stimulus
GO:0007154	0.367	cell communication
GO:0019222	0.364	regulation of metabolic process
GO:0007165	0.357	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.998	organelle
GO:0043227	0.980	membrane-bounded organelle
GO:0043229	0.973	intracellular organelle
GO:0043231	0.920	intracellular membrane-bounded organelle
GO:0016020	0.890	membrane
GO:0012505	0.552	endomembrane system
GO:0071944	0.469	cell periphery
GO:0005886	0.456	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.510	GTP + H2O = GDP + H(+) + phosphate

[back to server]