StarFunc result for job id Q96S97

User Input

>input (322 residues)
MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAW
TGSMGNWSMFTWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIY
PTTYVQFLSHGRSRDHAIAATFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLE
TFVACIIFAFISDPNLYQHQPALEWCVAVYAICFILAAIAILLNLGECTNVLPIPFPSFL
SGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCSRSHAYYVCAWDRRLAVAILT
AINLLAYVADLVHSAHLVFVKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96S97	1.000	1.000	2.428E-41	322	1.000	1.000	Q96S97.pdb.gz	MYADM_HUMAN Myeloid-associated differentiation marker OS=Homo sapiens OX=9606 GN=MYADM PE=1 SV=2
2	AFDB:A6NDP7	0.854	0.894	1.537E-18	307	0.376	0.394	A6NDP7.pdb.gz	MADL2_HUMAN Myeloid-associated differentiation marker-like protein 2 OS=Homo sapiens OX=9606 GN=MYADML2 PE=1 SV=3
3	AFDB:Q9Y342	0.357	0.609	8.448E-4	182	0.121	0.214	Q9Y342.pdb.gz	PLLP_HUMAN Plasmolipin OS=Homo sapiens OX=9606 GN=PLLP PE=1 SV=1
4	AFDB:P47987	0.374	0.636	1.176E-3	182	0.121	0.214	P47987.pdb.gz	PLLP_RAT Plasmolipin OS=Rattus norvegicus OX=10116 GN=Pllp PE=1 SV=2
5	AFDB:Q8IZV2	0.378	0.684	1.507E-3	173	0.109	0.202	Q8IZV2.pdb.gz	CKLF8_HUMAN CKLF-like MARVEL transmembrane domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CMTM8 PE=1 SV=2
6	AFDB:Q28296	0.372	0.757	4.064E-3	153	0.106	0.222	Q28296.pdb.gz	MAL_CANLF Myelin and lymphocyte protein OS=Canis lupus familiaris OX=9615 GN=MAL PE=2 SV=1
7	AFDB:A3KQ86	0.374	0.672	4.236E-3	173	0.099	0.185	A3KQ86.pdb.gz	A3KQ86_DANRE Novel protein similar to vertebrate transmembrane 4 superfamily member 11 (Plasmolipin) (TM4SF11) OS=Danio rerio OX=7955 GN=si:dkey-73n10.4 PE=4 SV=1
8	AFDB:Q7TPB7	0.371	0.661	4.415E-3	176	0.087	0.159	Q7TPB7.pdb.gz	Q7TPB7_RAT MAL2A OS=Rattus norvegicus OX=10116 GN=Mal2 PE=1 SV=1
9	AFDB:Q13021	0.372	0.752	4.601E-3	153	0.090	0.190	Q13021.pdb.gz	MALL_HUMAN MAL-like protein OS=Homo sapiens OX=9606 GN=MALL PE=1 SV=2
10	AFDB:P21145	0.386	0.787	4.795E-3	153	0.115	0.242	P21145.pdb.gz	MAL_HUMAN Myelin and lymphocyte protein OS=Homo sapiens OX=9606 GN=MAL PE=1 SV=1
11	PDB:6osaR	0.183	0.184	6.098E-2	321	0.137	0.137	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
12	PDB:7sk8A	0.199	0.206	6.624E-2	306	0.099	0.105	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
13	PDB:7cmuR	0.230	0.257	8.145E-2	272	0.102	0.121	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
14	PDB:7unmA	0.178	0.165	1.002E-1	368	0.127	0.111	7unmA.pdb.gz
15	PDB:7xtcR	0.228	0.257	1.283E-1	275	0.106	0.124	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
16	PDB:7f53R	0.161	0.172	1.714E-1	273	0.118	0.139	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
17	PDB:7jvrR	0.210	0.237	1.714E-1	269	0.096	0.115	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
18	PDB:7f4fR	0.158	0.172	2.022E-1	269	0.143	0.171	7f4fR.pdb.gz	Structural mechanism of calcium-mediated hormone recognition and G beta interaction by the human melanocortin-1 receptor.
19	PDB:7mbyR	0.203	0.223	2.108E-1	283	0.087	0.099	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
20	PDB:6wwzR	0.189	0.195	2.487E-1	310	0.115	0.119	6wwzR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96S97	0.0	649	322	1.000	1.000	MYADM_HUMAN Myeloid-associated differentiation marker OS=Homo sapiens OX=9606 GN=MYADM PE=1 SV=2
2	A6NDP7	2.56e-67	215	307	0.379	0.397	MADL2_HUMAN Myeloid-associated differentiation marker-like protein 2 OS=Homo sapiens OX=9606 GN=MYADML2 PE=1 SV=3
3	P21145	0.002	40.8	153	0.099	0.209	MAL_HUMAN Myelin and lymphocyte protein OS=Homo sapiens OX=9606 GN=MAL PE=1 SV=1
4	Q28296	0.009	38.5	153	0.087	0.183	MAL_CANLF Myelin and lymphocyte protein OS=Canis lupus familiaris OX=9615 GN=MAL PE=2 SV=1
5	Q64349	0.021	37.4	153	0.084	0.176	MAL_RAT Myelin and lymphocyte protein OS=Rattus norvegicus OX=10116 GN=Mal PE=2 SV=1
6	O09198	0.024	37.4	153	0.087	0.183	MAL_MOUSE Myelin and lymphocyte protein OS=Mus musculus OX=10090 GN=Mal PE=2 SV=1
7	Q9I9K6	0.062	36.2	159	0.081	0.164	Q9I9K6_XENLA Peptidyl-prolyl cis-trans isomerase OS=Xenopus laevis OX=8355 GN=pin1.L PE=1 SV=1
8	O22218	2.2	32.7	1030	0.043	0.014	ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA4 PE=1 SV=1
9	P47987	3.6	31.2	182	0.075	0.132	PLLP_RAT Plasmolipin OS=Rattus norvegicus OX=10116 GN=Pllp PE=1 SV=2
10	Q9Y342	5.9	30.4	182	0.087	0.154	PLLP_HUMAN Plasmolipin OS=Homo sapiens OX=9606 GN=PLLP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01284 MARVEL	1.4e-32	124.2	Membrane-associating domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219207	0.903	Plasmolipin
2	9606.ENSP00000377797	0.694	Ubiquitin carboxyl-terminal hydrolase 49
3	9606.ENSP00000230340	0.680	Bystin
4	9606.ENSP00000391596	0.656	N-acetylglucosamine-6-phosphate deacetylase
5	9606.ENSP00000238721	0.650	Quinone oxidoreductase PIG3
6	9606.ENSP00000441786	0.622	UPF0428 protein CXorf56
7	9606.ENSP00000255977	0.589	E3 ubiquitin-protein ligase makorin-1
8	9606.ENSP00000298694	0.589	Rho guanine nucleotide exchange factor 40
9	9606.ENSP00000323688	0.589	Olfactory receptor 5T2
10	9606.ENSP00000464342	0.561	60S ribosomal protein L36
11	9606.ENSP00000455561	0.537	Uncharacterized protein
12	9606.ENSP00000324196	0.531	Serine/threonine-protein kinase LMTK1
13	9606.ENSP00000288135	0.520	Mast/stem cell growth factor receptor Kit
14	9606.ENSP00000356033	0.515	T-cell activation Rho GTPase-activating protein
15	9606.ENSP00000395461	0.504	BTB/POZ domain-containing protein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0110053	0.981	regulation of actin filament organization
GO:0048523	0.975	negative regulation of cellular process
GO:0019222	0.958	regulation of metabolic process
GO:0048518	0.957	positive regulation of biological process
GO:0051179	0.949	localization
GO:0032535	0.940	regulation of cellular component size
GO:0044087	0.939	regulation of cellular component biogenesis
GO:0048522	0.930	positive regulation of cellular process
GO:0008064	0.917	regulation of actin polymerization or depolymerization
GO:0051129	0.916	negative regulation of cellular component organization
GO:0032271	0.914	regulation of protein polymerization
GO:0010810	0.913	regulation of cell-substrate adhesion
GO:0030833	0.896	regulation of actin filament polymerization
GO:1902904	0.884	negative regulation of supramolecular fiber organization
GO:0051494	0.884	negative regulation of cytoskeleton organization
GO:0031333	0.883	negative regulation of protein-containing complex assembly
GO:0048856	0.881	anatomical structure development
GO:0051246	0.875	regulation of protein metabolic process
GO:1900024	0.870	regulation of substrate adhesion-dependent cell spreading
GO:0030154	0.850	cell differentiation
GO:0009888	0.837	tissue development
GO:0030837	0.833	negative regulation of actin filament polymerization
GO:0048583	0.800	regulation of response to stimulus
GO:0003158	0.793	endothelium development
GO:0030855	0.724	epithelial cell differentiation
GO:0045785	0.723	positive regulation of cell adhesion
GO:0051641	0.708	cellular localization
GO:0010811	0.703	positive regulation of cell-substrate adhesion
GO:0009966	0.695	regulation of signal transduction
GO:0002064	0.691	epithelial cell development
GO:1900026	0.690	positive regulation of substrate adhesion-dependent cell spreading
GO:0001885	0.677	endothelial cell development
GO:0010468	0.661	regulation of gene expression
GO:0031323	0.595	regulation of cellular metabolic process
GO:0009892	0.579	negative regulation of metabolic process
GO:0051174	0.539	regulation of phosphorus metabolic process
GO:0019220	0.534	regulation of phosphate metabolic process
GO:0031399	0.531	regulation of protein modification process
GO:0010605	0.510	negative regulation of macromolecule metabolic process
GO:0042325	0.506	regulation of phosphorylation
GO:0031324	0.467	negative regulation of cellular metabolic process
GO:0051172	0.463	negative regulation of nitrogen compound metabolic process
GO:1902531	0.452	regulation of intracellular signal transduction
GO:0001932	0.442	regulation of protein phosphorylation
GO:0023057	0.416	negative regulation of signaling
GO:0010648	0.416	negative regulation of cell communication
GO:0051668	0.399	localization within membrane
GO:0045936	0.382	negative regulation of phosphate metabolic process
GO:0031400	0.368	negative regulation of protein modification process
GO:0042326	0.364	negative regulation of phosphorylation
GO:0040012	0.342	regulation of locomotion
GO:0001933	0.340	negative regulation of protein phosphorylation
GO:0007162	0.325	negative regulation of cell adhesion
GO:0061024	0.313	membrane organization
GO:0008104	0.313	protein localization
GO:0009968	0.302	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0098857	0.980	membrane microdomain
GO:0045121	0.971	membrane raft
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0030054	0.938	cell junction
GO:0120025	0.938	plasma membrane bounded cell projection
GO:0070161	0.933	anchoring junction
GO:0031252	0.931	cell leading edge
GO:0005856	0.929	cytoskeleton
GO:0005911	0.916	cell-cell junction
GO:0005938	0.911	cell cortex
GO:0015629	0.904	actin cytoskeleton
GO:0001726	0.893	ruffle
GO:0030864	0.885	cortical actin cytoskeleton
GO:0005829	0.480	cytosol
GO:0031982	0.449	vesicle
GO:0005634	0.431	nucleus
GO:0012505	0.423	endomembrane system
GO:0070013	0.417	intracellular organelle lumen
GO:0031981	0.413	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]