StarFunc result for job id Q96S99

User Input

>input (279 residues)
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQ
EWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICG
ASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96S99	1.000	1.000	1.355E-52	279	1.000	1.000	Q96S99.pdb.gz	PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3
2	AFDB:Q9H8W4	0.763	0.854	5.214E-33	249	0.495	0.554	Q9H8W4.pdb.gz	PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1
3	AFDB:O76902	0.782	0.693	1.115E-31	316	0.477	0.421	O76902.pdb.gz	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
4	AFDB:P34657	0.747	0.783	1.680E-28	266	0.430	0.451	P34657.pdb.gz	YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans OX=6239 GN=ZK632.12 PE=1 SV=2
5	AFDB:Q54DW7	0.696	0.212	1.488E-21	986	0.315	0.089	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
6	AFDB:Q6ZNL6	0.404	0.082	4.140E-16	1462	0.254	0.049	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
7	AFDB:Q7Z6J4	0.627	0.280	1.111E-14	655	0.211	0.090	Q7Z6J4.pdb.gz	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
8	AFDB:P98174	0.610	0.192	1.245E-14	961	0.211	0.061	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
9	AFDB:Q8BY35	0.626	0.279	2.074E-14	655	0.219	0.093	Q8BY35.pdb.gz	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
10	AFDB:Q96M96	0.420	0.178	3.657E-14	766	0.194	0.070	Q96M96.pdb.gz	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
11	PDB:7rx9A	0.385	0.255	3.002E-6	432	0.115	0.074	7rx9A.pdb.gz
12	PDB:5yqrA	0.322	0.334	3.177E-6	268	0.086	0.090	5yqrA.pdb.gz
13	PDB:6hhgA	0.286	0.211	3.642E-5	386	0.068	0.049	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
14	PDB:6s9wA	0.300	0.210	5.119E-5	411	0.075	0.051	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
15	PDB:4mt6A	0.375	0.278	9.553E-5	389	0.079	0.057	4mt6A.pdb.gz
16	PDB:3ljuX	0.280	0.214	1.070E-4	373	0.065	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:4mk0A	0.293	0.140	4.949E-4	631	0.093	0.041	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:6bbpA	0.273	0.152	5.868E-4	520	0.100	0.054	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:6u3eA	0.270	0.194	9.237E-4	397	0.100	0.071	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:4iapA	0.224	0.243	1.539E-3	256	0.054	0.059	4iapA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96S99	0.0	578	279	1.000	1.000	PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3
2	Q9H8W4	8.44e-98	289	249	0.462	0.518	PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1
3	O76902	7.44e-94	281	316	0.495	0.437	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
4	P34657	1.58e-75	233	266	0.412	0.432	YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans OX=6239 GN=ZK632.12 PE=1 SV=2
5	Q54DW7	1.29e-22	99.8	986	0.276	0.078	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
6	A0A2X0SFF2	2.12e-21	96.3	1462	0.240	0.046	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
7	Q6ZNL6	2.12e-21	96.3	1462	0.240	0.046	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
8	B7ZM68	2.83e-21	95.9	1178	0.240	0.057	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
9	Q49A55	1.70e-17	84.0	471	0.244	0.144	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
10	Q96M96	3.08e-17	83.6	766	0.244	0.089	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
11	O88387	3.68e-16	80.5	766	0.240	0.087	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
12	Q7Z6J4	4.04e-16	80.1	655	0.226	0.096	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
13	Q91ZT5	4.48e-16	80.1	766	0.244	0.089	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
14	Q8BY35	1.35e-15	78.6	655	0.222	0.095	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
15	Q960V6	7.53e-13	70.9	1343	0.125	0.026	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
16	Q7K9H6	7.81e-13	70.9	1343	0.125	0.026	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
17	P52734	8.88e-13	70.5	960	0.201	0.058	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
18	P98174	1.15e-12	70.1	961	0.201	0.058	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
19	E1C6T3	2.53e-11	66.2	1416	0.136	0.027	E1C6T3_CHICK Zinc finger FYVE domain-containing protein OS=Gallus gallus OX=9031 GN=ZFYVE9 PE=4 SV=2
20	O95405	3.80e-11	65.9	1425	0.133	0.026	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	2.3e-14	64.6	FYVE zinc finger
2	PF02318 FYVE_2	7.4	18.2	FYVE-type zinc finger
3	PF16453 IQ_SEC7_PH	5.9	18.2	PH domain
4	PF00169 PH	2.6e-06	39.2	PH domain
5	PF16652 PH_13	0.11	23.8	Pleckstrin homology domain
6	PF19057 PH_19	12	17.0	PH domain
7	PF15406 PH_6	3.1e+02	13.0	Pleckstrin homology domain
8	PF04381 RdgC	48	14.7	Putative exonuclease, RdgC

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465213	0.735	Ribonuclease P protein subunit p29
2	9606.ENSP00000335038	0.644	V-set and transmembrane domain containing 2B
3	9606.ENSP00000161006	0.625	Brain-specific serine protease 4
4	9606.ENSP00000342105	0.597	Dual specificity tyrosine-phosphorylation-regulated kinase 2
5	9606.ENSP00000292782	0.591	DCN1-like protein 1
6	9606.ENSP00000376103	0.561	Protein C19orf12
7	9606.ENSP00000480798	0.558	NEDD4 family-interacting protein 2
8	9606.ENSP00000381823	0.547	Protein transport protein Sec24A
9	9606.ENSP00000417706	0.536	DCN1-like protein 2
10	9606.ENSP00000266022	0.530	RNA-binding protein 6
11	9606.ENSP00000368341	0.528	RNA-binding protein 24
12	9606.ENSP00000376097	0.520	Unconventional prefoldin RPB5 interactor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070273	0.999	phosphatidylinositol-4-phosphate binding
GO:0032266	0.999	phosphatidylinositol-3-phosphate binding
GO:0010314	0.999	phosphatidylinositol-5-phosphate binding
GO:0003824	0.411	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0048522	0.969	positive regulation of cellular process
GO:0009893	0.954	positive regulation of metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0007032	0.935	endosome organization
GO:0051179	0.923	localization
GO:0033036	0.898	macromolecule localization
GO:0009894	0.878	regulation of catabolic process
GO:0072659	0.873	protein localization to plasma membrane
GO:0031325	0.820	positive regulation of cellular metabolic process
GO:0010506	0.802	regulation of autophagy
GO:0031331	0.772	positive regulation of cellular catabolic process
GO:0010508	0.670	positive regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0097708	0.996	intracellular vesicle
GO:0031410	0.994	cytoplasmic vesicle
GO:0031090	0.986	organelle membrane
GO:0098588	0.972	bounding membrane of organelle
GO:0005768	0.935	endosome
GO:0000323	0.856	lytic vacuole
GO:0030659	0.837	cytoplasmic vesicle membrane
GO:0005764	0.831	lysosome
GO:0005765	0.777	lysosomal membrane
GO:0010008	0.613	endosome membrane
GO:0005829	0.398	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]