StarFunc result for job id Q96SA4

User Input

>input (455 residues)
MGACLGACSLLSCASCLCGSAPCILCSCCPASRNSTVSRLIFTFFLFLGVLVSIIMLSPG
VESQLYKLPWVCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
SRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSFTNIWFYFGVVGSFLFILIQLVLLID
FAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFMYYTEPSGCHEGKVFI
SLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPT
QLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSLMQTEECPPML
DATQQQQQVAACEGRAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMIS
TWTAVWVKICASWAGLLLYLWTLVAPLLLRNRDFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96SA4	1.000	1.000	6.562E-64	455	1.000	1.000	Q96SA4.pdb.gz	SERC2_HUMAN Serine incorporator 2 OS=Homo sapiens OX=9606 GN=SERINC2 PE=2 SV=3
2	AFDB:Q4FZV1	0.952	0.962	2.626E-52	450	0.851	0.860	Q4FZV1.pdb.gz	Q4FZV1_RAT Serine incorporator 2 OS=Rattus norvegicus OX=10116 GN=Serinc2 PE=2 SV=1
3	AFDB:Q7TNK0	0.893	0.897	2.422E-40	453	0.549	0.552	Q7TNK0.pdb.gz	SERC1_RAT Serine incorporator 1 OS=Rattus norvegicus OX=10116 GN=Serinc1 PE=1 SV=1
4	AFDB:Q9QZI9	0.894	0.863	7.391E-36	472	0.536	0.517	Q9QZI9.pdb.gz	SERC3_MOUSE Serine incorporator 3 OS=Mus musculus OX=10090 GN=Serinc3 PE=1 SV=2
5	AFDB:Q13530	0.885	0.853	2.643E-35	473	0.530	0.510	Q13530.pdb.gz	SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens OX=9606 GN=SERINC3 PE=1 SV=2
6	AFDB:Q8BHJ6	0.774	0.764	8.342E-23	461	0.376	0.371	Q8BHJ6.pdb.gz	SERC5_MOUSE Serine incorporator 5 OS=Mus musculus OX=10090 GN=Serinc5 PE=2 SV=1
7	PDB:7ru6A	0.655	0.934	1.448E-22	315	0.396	0.571	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
8	AFDB:Q86VE9	0.719	0.769	9.025E-20	423	0.343	0.369	Q86VE9.pdb.gz	SERC5_HUMAN Serine incorporator 5 OS=Homo sapiens OX=9606 GN=SERINC5 PE=2 SV=1
9	AFDB:Q12116	0.574	0.554	3.313E-18	473	0.242	0.233	Q12116.pdb.gz	TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMS1 PE=1 SV=1
10	AFDB:Q93YS8	0.614	0.696	1.462E-14	394	0.215	0.249	Q93YS8.pdb.gz	Q93YS8_ARATH Serinc-domain containing serine and sphingolipid biosynthesis protein OS=Arabidopsis thaliana OX=3702 GN=MEE55 PE=2 SV=1
11	AFDB:Q86K54	0.513	0.677	2.873E-5	333	0.127	0.174	Q86K54.pdb.gz	Q86K54_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277237 PE=4 SV=1
12	PDB:7p5cA	0.104	0.113	3.128E-1	392	0.105	0.122	7p5cA.pdb.gz
13	PDB:7p5jA	0.105	0.116	3.415E-1	399	0.116	0.133	7p5jA.pdb.gz
14	PDB:2wsxA	0.139	0.133	3.569E-1	496	0.112	0.103	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
15	PDB:4iu8B	0.116	0.121	4.446E-1	427	0.095	0.101	4iu8B.pdb.gz	Structure and mechanism of a nitrate transporter.
16	PDB:7p9uB	0.142	0.142	5.072E-1	455	0.132	0.132	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
17	PDB:7sl9A	0.110	0.104	5.538E-1	497	0.119	0.109	7sl9A.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
18	PDB:6bgjA	0.133	0.126	7.532E-1	490	0.121	0.112	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
19	PDB:7dskB	0.107	0.106	9.383E-1	464	0.127	0.125	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
20	PDB:3p03A	0.127	0.119	1.024	504	0.105	0.095	3p03A.pdb.gz	Substrate specificity and ion coupling in the Na(+)/betaine symporter BetP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4FZV1	0.0	743	450	0.851	0.860	Q4FZV1_RAT Serine incorporator 2 OS=Rattus norvegicus OX=10116 GN=Serinc2 PE=2 SV=1
2	Q7TNK0	0.0	521	453	0.545	0.547	SERC1_RAT Serine incorporator 1 OS=Rattus norvegicus OX=10116 GN=Serinc1 PE=1 SV=1
3	Q96SA4	0.0	929	455	1.000	1.000	SERC2_HUMAN Serine incorporator 2 OS=Homo sapiens OX=9606 GN=SERINC2 PE=2 SV=3
4	Q9QZI8	0.0	521	453	0.549	0.552	SERC1_MOUSE Serine incorporator 1 OS=Mus musculus OX=10090 GN=Serinc1 PE=1 SV=1
5	Q9NRX5	7.56e-176	502	453	0.552	0.554	SERC1_HUMAN Serine incorporator 1 OS=Homo sapiens OX=9606 GN=SERINC1 PE=1 SV=1
6	Q13530	1.13e-162	469	473	0.532	0.512	SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens OX=9606 GN=SERINC3 PE=1 SV=2
7	Q9QZI9	6.39e-149	434	472	0.538	0.519	SERC3_MOUSE Serine incorporator 3 OS=Mus musculus OX=10090 GN=Serinc3 PE=1 SV=2
8	Q8BHJ6	1.71e-97	302	461	0.382	0.377	SERC5_MOUSE Serine incorporator 5 OS=Mus musculus OX=10090 GN=Serinc5 PE=2 SV=1
9	Q63175	4.74e-91	285	460	0.365	0.361	SERC5_RAT Serine incorporator 5 OS=Rattus norvegicus OX=10116 GN=Serinc5 PE=2 SV=1
10	Q86VE9	8.64e-86	271	423	0.343	0.369	SERC5_HUMAN Serine incorporator 5 OS=Homo sapiens OX=9606 GN=SERINC5 PE=2 SV=1
11	Q12116	6.66e-36	140	473	0.240	0.230	TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMS1 PE=1 SV=1
12	Q93YS8	2.97e-28	117	394	0.211	0.244	Q93YS8_ARATH Serinc-domain containing serine and sphingolipid biosynthesis protein OS=Arabidopsis thaliana OX=3702 GN=MEE55 PE=2 SV=1
13	Q3EAE5	0.17	36.6	441	0.077	0.079	FDL24_ARATH Putative F-box/FBD/LRR-repeat protein At4g00315 OS=Arabidopsis thaliana OX=3702 GN=At4g00315 PE=4 SV=1
14	Q9H7F0	1.4	33.9	1226	0.090	0.033	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
15	F4I1V3	7.9	31.6	492	0.051	0.047	F4I1V3_ARATH FBD, F-box and Leucine Rich Repeat domains containing protein OS=Arabidopsis thaliana OX=3702 GN=FOF2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03348 Serinc	1.2e-154	527.1	Serine incorporator (Serinc)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010352008.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010370405.1	0.692	Arylacetamide deacetylase
2	61622.XP_010385976.1	0.648	G-protein coupled receptor family C group 5 member C isoform X1
3	61622.XP_010365188.1	0.610	ClpB homolog, mitochondrial AAA ATPase chaperonin
4	61622.XP_010351422.1	0.597	ATP-binding cassette sub-family A member 6
5	61622.XP_010385315.1	0.594	Lysosomal-associated transmembrane protein 5
6	61622.XP_010365167.1	0.577	StAR related lipid transfer domain containing 10
7	61622.XP_010383860.1	0.568	ER membrane protein complex subunit 1 isoform X1
8	61622.XP_010351996.1	0.567	Zinc finger CCHC-type containing 17
9	61622.XP_010365168.1	0.566	arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 isoform X1
10	61622.XP_010351934.1	0.548	Sodium/potassium transporting ATPase interacting 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.968	transmembrane transporter activity
GO:0022889	0.948	serine transmembrane transporter activity
GO:0015179	0.947	L-amino acid transmembrane transporter activity
GO:0015194	0.594	L-serine transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.984	biological regulation
GO:0044237	0.978	cellular metabolic process
GO:0071704	0.976	organic substance metabolic process
GO:0006807	0.954	nitrogen compound metabolic process
GO:0044238	0.932	primary metabolic process
GO:0050790	0.869	regulation of catalytic activity
GO:1901564	0.859	organonitrogen compound metabolic process
GO:0044093	0.725	positive regulation of molecular function
GO:0006575	0.714	cellular modified amino acid metabolic process
GO:0043085	0.683	positive regulation of catalytic activity
GO:0006796	0.665	phosphate-containing compound metabolic process
GO:0006629	0.605	lipid metabolic process
GO:0051338	0.555	regulation of transferase activity
GO:0050789	0.550	regulation of biological process
GO:0044255	0.549	cellular lipid metabolic process
GO:0019637	0.547	organophosphate metabolic process
GO:0050794	0.542	regulation of cellular process
GO:0046486	0.477	glycerolipid metabolic process
GO:0050896	0.454	response to stimulus
GO:0006644	0.440	phospholipid metabolic process
GO:0051347	0.303	positive regulation of transferase activity
GO:0006650	0.303	glycerophospholipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0016020	0.973	membrane
GO:0005622	0.959	intracellular anatomical structure
GO:0043229	0.946	intracellular organelle
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0071944	0.920	cell periphery
GO:0031982	0.915	vesicle
GO:0005737	0.909	cytoplasm
GO:0005576	0.897	extracellular region
GO:0043230	0.744	extracellular organelle
GO:0005886	0.735	plasma membrane
GO:0005615	0.696	extracellular space
GO:1903561	0.676	extracellular vesicle
GO:0070062	0.640	extracellular exosome
GO:0012505	0.407	endomembrane system
GO:0005794	0.306	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:35031	0.948	L-serine(in) = L-serine(out)

[back to server]