StarFunc result for job id Q96SB3

User Input

>input (817 residues)
MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSM
FLQMGTTAGPSGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSER
VSRFDSKPAPSAQPAPPPHPPSRLQETRKLFERSAPAAAGGDKEAAARRLLRQERAGLQD
RKLDVVVRFNGSTEALDKLDADAVSPTVSQLSAVFEKADSRTGLHRGPGLPRAAGVPQVN
SKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHRVAPARPPPKPREVRKIKP
VEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVA
PPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEED
GEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAAS
AEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRD
GRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLE
QERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGGEMAIEVFELAENEDALSPV
DMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRWRVEKAQLEQSVEENKERM
EKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQR
RVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35274	0.588	0.588	0.000	817	0.956	0.956	O35274.pdb.gz	NEB2_RAT Neurabin-2 OS=Rattus norvegicus OX=10116 GN=Ppp1r9b PE=1 SV=1
2	AFDB:H3BJD0	0.412	0.351	9.588E-57	977	0.472	0.395	H3BJD0.pdb.gz	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
3	AFDB:B1Q240	0.114	0.104	4.366E-9	915	0.165	0.148	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
4	PDB:7pc3A	0.104	0.208	7.201E-9	405	0.038	0.077	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
5	PDB:7p73A	0.103	0.196	2.082E-7	420	0.033	0.064	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
6	AFDB:Q9W283	0.109	0.069	6.193E-7	1329	0.121	0.074	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
7	PDB:2xkxA	0.106	0.119	7.998E-7	721	0.037	0.042	2xkxA.pdb.gz
8	PDB:5n7dA	0.108	0.203	8.502E-7	423	0.026	0.050	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
9	PDB:7qqmA	0.105	0.202	1.771E-6	413	0.038	0.075	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
10	PDB:7p70A	0.105	0.208	5.011E-6	407	0.032	0.064	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	AFDB:Q96NW7	0.102	0.056	7.153E-6	1537	0.131	0.070	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
12	AFDB:P70587	0.102	0.057	9.136E-6	1490	0.132	0.072	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
13	PDB:7pcbA	0.108	0.203	1.810E-5	415	0.028	0.055	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7pc5A	0.100	0.196	2.312E-5	405	0.034	0.069	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7pe9I	0.108	0.267	5.445E-5	317	0.031	0.079	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:7qqnC	0.094	0.180	6.541E-5	414	0.020	0.039	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	AFDB:Q96RT1	0.102	0.061	3.051E-3	1412	0.119	0.069	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
18	AFDB:M9PC26	0.102	0.044	5.291E-3	2021	0.118	0.048	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
19	AFDB:Q9LFA2	0.055	0.052	6.758E-3	934	0.109	0.095	Q9LFA2.pdb.gz	KIPK1_ARATH Serine/threonine-protein kinase KIPK1 OS=Arabidopsis thaliana OX=3702 GN=KIPK1 PE=1 SV=1
20	AFDB:Q80TH2	0.101	0.061	7.637E-3	1402	0.140	0.081	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BKQ7	0.0	551	955	0.334	0.286	H3BKQ7_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
2	H3BL28	0.0	552	1042	0.334	0.262	H3BL28_MOUSE Protein phosphatase 1, regulatory subunit 9A (Fragment) OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
3	H9FWV3	0.0	561	1311	0.337	0.210	H9FWV3_MACMU Neurabin-1 isoform 1 OS=Macaca mulatta OX=9544 GN=PPP1R9A PE=2 SV=1
4	O35274	0.0	1432	817	0.955	0.955	NEB2_RAT Neurabin-2 OS=Rattus norvegicus OX=10116 GN=Ppp1r9b PE=1 SV=1
5	O35867	0.0	637	1095	0.503	0.375	NEB1_RAT Neurabin-1 OS=Rattus norvegicus OX=10116 GN=Ppp1r9a PE=1 SV=1
6	Q3UUK5	0.0	552	1042	0.334	0.262	Q3UUK5_MOUSE Neurabin-1 (Fragment) OS=Mus musculus OX=10090 GN=Ppp1r9a PE=2 SV=1
7	Q6R891	0.0	1571	817	0.965	0.965	NEB2_MOUSE Neurabin-2 OS=Mus musculus OX=10090 GN=Ppp1r9b PE=1 SV=1
8	Q7TN74	0.0	553	1095	0.334	0.249	Q7TN74_MOUSE Neurabin I OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
9	Q96SB3	0.0	1639	817	1.000	1.000	NEB2_HUMAN Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=3
10	Q9ULJ8	0.0	632	1098	0.504	0.375	NEB1_HUMAN Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9A PE=1 SV=2
11	H3BJD6	7.25e-180	553	1292	0.334	0.211	H3BJD6_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
12	H3BJD0	5.94e-178	539	977	0.334	0.279	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
13	Q3UXW4	5.77e-97	317	642	0.187	0.238	Q3UXW4_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
14	H5V864	3.73e-88	308	2137	0.224	0.086	H5V864_DROME FI18374p1 OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
15	M9NEY5	8.71e-87	304	2121	0.222	0.085	M9NEY5_DROME Spinophilin, isoform G OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
16	M9NFI9	9.63e-87	304	2148	0.222	0.084	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
17	M9NEY3	1.01e-86	304	2134	0.222	0.085	M9NEY3_DROME Spinophilin, isoform B OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
18	M9ND28	1.12e-86	304	1684	0.219	0.106	M9ND28_DROME Spinophilin, isoform F OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
19	Q8MSU5	1.22e-86	304	1858	0.222	0.097	Q8MSU5_DROME LD45234p OS=Drosophila melanogaster OX=7227 GN=Spn PE=2 SV=1
20	X2JC06	1.60e-86	303	1831	0.219	0.098	X2JC06_DROME Spinophilin, isoform T OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	8.8e+02	11.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF00595 PDZ	1.1e-09	49.8	PDZ domain
3	PF17817 PDZ_5	5.4e-28	108.3	PDZ domain
4	PF17820 PDZ_6	0.017	26.4	PDZ domain
5	PF04508 Pox_A_type_inc	8.6e+02	11.2	Viral A-type inclusion protein repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.998	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000326031	0.997	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000378769	0.990	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
4	9606.ENSP00000235382	0.967	Regulator of G-protein signaling 2
5	9606.ENSP00000389168	0.959	Protein phosphatase 1 regulatory subunit 12A
6	9606.ENSP00000337697	0.945	Neuronal migration protein doublecortin
7	9606.ENSP00000356156	0.933	Protein phosphatase 1 regulatory subunit 15B
8	9606.ENSP00000418447	0.933	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
9	9606.ENSP00000261461	0.929	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
10	9606.ENSP00000325074	0.921	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
11	9606.ENSP00000324804	0.920	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
12	9606.ENSP00000378323	0.918	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
13	9606.ENSP00000378306	0.915	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
14	9606.ENSP00000221138	0.913	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
15	9606.ENSP00000365694	0.912	Serine/threonine-protein phosphatase 1 regulatory subunit 10
16	9606.ENSP00000296490	0.909	WD repeat-containing protein 82
17	9606.ENSP00000234310	0.907	Calcineurin subunit B type 1
18	9606.ENSP00000412324	0.906	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
19	9606.ENSP00000305924	0.905	Serine/threonine-protein phosphatase 4 regulatory subunit 4
20	9606.ENSP00000461749	0.903	CTD nuclear envelope phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003779	0.992	actin binding
GO:0005102	0.913	signaling receptor binding
GO:0044877	0.886	protein-containing complex binding
GO:0051015	0.855	actin filament binding
GO:0098772	0.682	molecular function regulator activity
GO:0019899	0.659	enzyme binding
GO:0003824	0.658	catalytic activity
GO:0030234	0.636	enzyme regulator activity
GO:0097159	0.630	organic cyclic compound binding
GO:0019888	0.595	protein phosphatase regulator activity
GO:0140096	0.554	catalytic activity, acting on a protein
GO:0019900	0.554	kinase binding
GO:0044325	0.529	transmembrane transporter binding
GO:1901363	0.527	heterocyclic compound binding
GO:0031749	0.519	D2 dopamine receptor binding
GO:0008157	0.516	protein phosphatase 1 binding
GO:0003676	0.512	nucleic acid binding
GO:0004864	0.509	protein phosphatase inhibitor activity
GO:0016772	0.475	transferase activity, transferring phosphorus-containing groups
GO:0016301	0.467	kinase activity
GO:0004672	0.420	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0016043	0.965	cellular component organization
GO:0048519	0.883	negative regulation of biological process
GO:0007154	0.877	cell communication
GO:0048523	0.843	negative regulation of cellular process
GO:0051171	0.820	regulation of nitrogen compound metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0031323	0.815	regulation of cellular metabolic process
GO:0060255	0.806	regulation of macromolecule metabolic process
GO:0032501	0.761	multicellular organismal process
GO:0006996	0.745	organelle organization
GO:0042221	0.693	response to chemical
GO:0048518	0.674	positive regulation of biological process
GO:0007010	0.649	cytoskeleton organization
GO:0051246	0.629	regulation of protein metabolic process
GO:0048522	0.628	positive regulation of cellular process
GO:0032502	0.596	developmental process
GO:0030029	0.588	actin filament-based process
GO:0007015	0.571	actin filament organization
GO:0023052	0.560	signaling
GO:0007165	0.536	signal transduction
GO:0065009	0.488	regulation of molecular function
GO:0010646	0.431	regulation of cell communication
GO:0048583	0.430	regulation of response to stimulus
GO:0051179	0.413	localization
GO:0048856	0.408	anatomical structure development
GO:0023051	0.403	regulation of signaling
GO:0010033	0.400	response to organic substance
GO:0031399	0.393	regulation of protein modification process
GO:0019220	0.385	regulation of phosphate metabolic process
GO:0120036	0.329	plasma membrane bounded cell projection organization
GO:0007275	0.320	multicellular organism development
GO:0008152	0.314	metabolic process
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.994	cytoplasm
GO:0120025	0.992	plasma membrane bounded cell projection
GO:0005886	0.990	plasma membrane
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005856	0.983	cytoskeleton
GO:0032991	0.981	protein-containing complex
GO:0005829	0.963	cytosol
GO:0005634	0.941	nucleus
GO:0070013	0.934	intracellular organelle lumen
GO:0015629	0.926	actin cytoskeleton
GO:0031981	0.923	nuclear lumen
GO:0030054	0.898	cell junction
GO:0005654	0.884	nucleoplasm
GO:0043005	0.810	neuron projection
GO:0030175	0.801	filopodium
GO:1902494	0.763	catalytic complex
GO:0031252	0.713	cell leading edge
GO:0045202	0.712	synapse
GO:0098590	0.696	plasma membrane region
GO:0005938	0.568	cell cortex
GO:0036477	0.567	somatodendritic compartment
GO:0097447	0.536	dendritic tree
GO:0030425	0.528	dendrite
GO:0098794	0.510	postsynapse
GO:0031253	0.444	cell projection membrane
GO:0043197	0.443	dendritic spine
GO:0012505	0.414	endomembrane system
GO:1990780	0.379	cytoplasmic side of dendritic spine plasma membrane
GO:0044326	0.361	dendritic spine neck
GO:0030863	0.356	cortical cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.475	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.420	Phosphotransferases with an alcohol group as acceptor.

[back to server]