StarFunc result for job id Q96SB4

User Input

>input (655 residues)
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BLV9	0.730	0.713	2.958E-93	671	0.994	0.970	H3BLV9.pdb.gz	H3BLV9_HUMAN SRSF protein kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=1
2	AFDB:A0A024R704	0.656	0.625	6.097E-68	688	0.588	0.560	A0A024R704.pdb.gz
3	AFDB:Q9UPE1	0.644	0.742	2.127E-61	567	0.508	0.587	Q9UPE1.pdb.gz	SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens OX=9606 GN=SRPK3 PE=1 SV=2
4	AFDB:Q0E965	0.617	0.530	3.397E-56	764	0.461	0.395	Q0E965.pdb.gz	Q0E965_DROME SR protein kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=SRPK PE=1 SV=1
5	PDB:6fadC	0.542	0.984	1.120E-53	359	0.548	1.000	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
6	AFDB:M9NDZ1	0.565	0.415	3.897E-50	898	0.405	0.295	M9NDZ1.pdb.gz	M9NDZ1_DROME Serine-arginine protein kinase at 79D, isoform I OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
7	AFDB:M9PDA8	0.566	0.465	9.203E-50	802	0.395	0.323	M9PDA8.pdb.gz	M9PDA8_DROME Serine-arginine protein kinase at 79D, isoform E OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
8	AFDB:M9MS50	0.551	0.417	1.018E-49	869	0.386	0.291	M9MS50.pdb.gz	M9MS50_DROME Serine-arginine protein kinase at 79D, isoform F OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
9	AFDB:M9NEI4	0.566	0.388	1.071E-49	965	0.405	0.275	M9NEI4.pdb.gz	M9NEI4_DROME Serine-arginine protein kinase at 79D, isoform J OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
10	AFDB:Q8T3S1	0.573	0.503	1.185E-49	749	0.386	0.338	Q8T3S1.pdb.gz	Q8T3S1_DROME AT02150p OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=2 SV=1
11	AFDB:M9NDF9	0.566	0.393	1.066E-47	951	0.405	0.279	M9NDF9.pdb.gz	M9NDF9_DROME Serine-arginine protein kinase at 79D, isoform L OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
12	PDB:6kheA	0.432	0.807	1.751E-18	342	0.173	0.330	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
13	PDB:5y86A	0.423	0.685	1.982E-17	395	0.173	0.286	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
14	PDB:6khdB	0.421	0.801	2.193E-17	332	0.159	0.313	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
15	PDB:6qx9K	0.430	0.847	6.669E-17	322	0.147	0.298	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
16	PDB:4krcA	0.382	0.795	3.094E-13	297	0.147	0.323	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1unlA	0.378	0.810	7.477E-12	292	0.128	0.288	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:4eomC	0.344	0.777	2.162E-11	276	0.131	0.312	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:7cgaA	0.387	0.694	9.850E-11	347	0.136	0.256	7cgaA.pdb.gz
20	PDB:5oniA	0.365	0.675	1.268E-10	334	0.113	0.222	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BLV9	0.0	1352	671	0.994	0.970	H3BLV9_HUMAN SRSF protein kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=1
2	O54781	0.0	723	681	0.598	0.576	SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus OX=10090 GN=Srpk2 PE=1 SV=2
3	O70551	0.0	1176	648	0.916	0.926	SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus OX=10090 GN=Srpk1 PE=1 SV=2
4	Q96SB4	0.0	1363	655	1.000	1.000	SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2
5	P78362	1.73e-136	417	688	0.310	0.295	SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3
6	Q9Z0G2	1.25e-127	390	565	0.293	0.340	SRPK3_MOUSE SRSF protein kinase 3 OS=Mus musculus OX=10090 GN=Srpk3 PE=1 SV=1
7	Q9UPE1	2.44e-127	389	567	0.287	0.332	SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens OX=9606 GN=SRPK3 PE=1 SV=2
8	H7C5L6	1.67e-112	342	295	0.231	0.512	H7C5L6_HUMAN SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=2
9	Q9GSP5	1.71e-88	294	764	0.241	0.207	Q9GSP5_DROME SR protein kinase 1 OS=Drosophila melanogaster OX=7227 GN=SRPK PE=2 SV=1
10	Q0E965	1.84e-88	293	764	0.241	0.207	Q0E965_DROME SR protein kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=SRPK PE=1 SV=1
11	A0A0B4KF69	2.36e-87	294	939	0.241	0.168	A0A0B4KF69_DROME SR protein kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=SRPK PE=1 SV=1
12	Q95SW3	3.01e-86	274	315	0.182	0.378	Q95SW3_DROME SD03158p (Fragment) OS=Drosophila melanogaster OX=7227 GN=SRPK PE=2 SV=2
13	Q03563	2.17e-85	290	1003	0.253	0.166	SPK1_CAEEL Serine/threonine-protein kinase spk-1 OS=Caenorhabditis elegans OX=6239 GN=spk-1 PE=2 SV=3
14	A1ZA05	2.74e-82	273	607	0.182	0.196	A1ZA05_DROME SR protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=SRPK PE=1 SV=1
15	Q8SWX7	1.53e-73	252	695	0.173	0.163	Q8SWX7_DROME GH08190p OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=2 SV=1
16	Q9VNV0	8.02e-73	253	816	0.173	0.138	Q9VNV0_DROME Serine-arginine protein kinase at 79D, isoform H OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=5
17	M9MS50	1.18e-72	253	869	0.173	0.130	M9MS50_DROME Serine-arginine protein kinase at 79D, isoform F OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
18	Q8T3S1	2.20e-72	250	749	0.171	0.150	Q8T3S1_DROME AT02150p OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=2 SV=1
19	M9NEI4	3.33e-72	253	965	0.173	0.117	M9NEI4_DROME Serine-arginine protein kinase at 79D, isoform J OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
20	M9NGC6	3.56e-72	254	1018	0.173	0.111	M9NGC6_DROME Serine-arginine protein kinase at 79D, isoform K OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	1.4e-37	141.1	Protein kinase domain
2	PF17667 Pkinase_fungal	68	13.7	Fungal protein kinase
3	PF07714 PK_Tyr_Ser-Thr	2.9e-10	51.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362931

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258962	0.998	Serine/arginine-rich splicing factor 1
2	9606.ENSP00000244020	0.986	Serine/arginine-rich splicing factor 6
3	9606.ENSP00000376276	0.982	Serine/arginine-rich splicing factor 2
4	9606.ENSP00000452123	0.975	Serine/arginine-rich splicing factor 5
5	9606.ENSP00000362900	0.972	Serine/arginine-rich splicing factor 4
6	9606.ENSP00000362820	0.968	Serine/arginine-rich splicing factor 3
7	9606.ENSP00000307863	0.958	Splicing factor U2AF 65 kDa subunit
8	9606.ENSP00000310723	0.939	Probable ATP-dependent RNA helicase DDX23
9	9606.ENSP00000229390	0.921	Serine/arginine-rich splicing factor 9
10	9606.ENSP00000291552	0.921	U2 small nuclear RNA auxiliary factor 1
11	9606.ENSP00000325905	0.921	Serine/arginine-rich splicing factor 7
12	9606.ENSP00000472998	0.898	U1 small nuclear ribonucleoprotein 70 kDa
13	9606.ENSP00000257181	0.877	Pre-mRNA-splicing factor 38A
14	9606.ENSP00000480140	0.871	Serine/arginine-rich splicing factor 8
15	9606.ENSP00000467423	0.866	Scaffold attachment factor B1
16	9606.ENSP00000293872	0.838	Putative RNA-binding protein Luc7-like 1
17	9606.ENSP00000425979	0.820	Ribonuclease 3
18	9606.ENSP00000216832	0.812	Pinin
19	9606.ENSP00000360532	0.793	Cell division cycle 5-like protein
20	9606.ENSP00000425092	0.772	Luc7-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0046872	0.997	metal ion binding
GO:0005524	0.996	ATP binding
GO:0000287	0.993	magnesium ion binding
GO:0003676	0.970	nucleic acid binding
GO:0003723	0.963	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0006468	0.986	protein phosphorylation
GO:0031323	0.985	regulation of cellular metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0051252	0.971	regulation of RNA metabolic process
GO:0051716	0.956	cellular response to stimulus
GO:0023052	0.889	signaling
GO:1903311	0.842	regulation of mRNA metabolic process
GO:0007154	0.820	cell communication
GO:0050684	0.778	regulation of mRNA processing
GO:0034641	0.569	cellular nitrogen compound metabolic process
GO:1901360	0.546	organic cyclic compound metabolic process
GO:0046483	0.546	heterocycle metabolic process
GO:0006725	0.546	cellular aromatic compound metabolic process
GO:0006139	0.543	nucleobase-containing compound metabolic process
GO:0090304	0.486	nucleic acid metabolic process
GO:0010468	0.457	regulation of gene expression
GO:0007165	0.408	signal transduction
GO:0048518	0.403	positive regulation of biological process
GO:0048519	0.362	negative regulation of biological process
GO:0035556	0.335	intracellular signal transduction
GO:0016043	0.328	cellular component organization
GO:0006396	0.309	RNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0071944	0.990	cell periphery
GO:0016020	0.989	membrane
GO:0005886	0.958	plasma membrane
GO:0016604	0.935	nuclear body
GO:0016607	0.711	nuclear speck
GO:0032991	0.325	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]