StarFunc result for job id Q96SB8

User Input

>input (1091 residues)
MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHS
MLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADIS
ITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNI
QVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIMETKERTKEQIHQG
EERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVNEIEKQLNAIRDNIKIG
EDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALKADVVAKKRAY
NEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAF
QNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRF
GPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHA
DERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVAN
SLIDMRGIETVLLIKNNSVARAVMQSQKPPKNCREAFTADGDQVFAGRYYSSENTRPKFL
SRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNEELLKRCQLHYKELKMKIRKN
ISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLKSLKIEAENKY
DAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKE
KELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARE
TYLDLDSKVRTLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNF
DHKNETLSISVQPGEGNKAAFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVY
MDMVNRRIAMDLILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFR
PVTQEEDDDQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924W5	0.560	0.558	0.000	1097	0.904	0.899	Q924W5.pdb.gz	SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus OX=10090 GN=Smc6 PE=1 SV=1
2	AFDB:C9JMN1	0.292	0.424	5.011E-97	740	0.653	0.962	C9JMN1.pdb.gz	C9JMN1_HUMAN Structural maintenance of chromosomes 6 (Fragment) OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=1
3	AFDB:P53692	0.426	0.409	1.886E-72	1140	0.268	0.256	P53692.pdb.gz	SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc6 PE=1 SV=1
4	AFDB:Q9FLR5	0.397	0.407	1.983E-70	1058	0.250	0.258	Q9FLR5.pdb.gz	SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana OX=3702 GN=SMC6A PE=2 SV=1
5	AFDB:Q9FII7	0.373	0.383	3.411E-69	1057	0.236	0.244	Q9FII7.pdb.gz	SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana OX=3702 GN=SMC6B PE=2 SV=1
6	AFDB:Q9VCB8	0.353	0.344	8.873E-68	1122	0.247	0.241	Q9VCB8.pdb.gz	Q9VCB8_DROME Java no jive OS=Drosophila melanogaster OX=7227 GN=SMC6 PE=1 SV=1
7	AFDB:Q12749	0.426	0.418	3.977E-67	1114	0.230	0.225	Q12749.pdb.gz	SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC6 PE=1 SV=1
8	AFDB:G5EG17	0.424	0.405	2.556E-64	1149	0.230	0.218	G5EG17.pdb.gz	SMC6_CAEEL Structural maintenance of chromosomes protein 6 homolog smc-6 OS=Caenorhabditis elegans OX=6239 GN=smc-6 PE=1 SV=1
9	PDB:7qcdB	0.368	0.397	1.075E-47	998	0.228	0.249	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
10	AFDB:O13710	0.277	0.281	6.069E-46	1076	0.177	0.179	O13710.pdb.gz	SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc5 PE=1 SV=3
11	AFDB:Q8CG46	0.284	0.281	1.994E-45	1101	0.166	0.164	Q8CG46.pdb.gz	SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus OX=10090 GN=Smc5 PE=1 SV=1
12	PDB:7qcdA	0.261	0.275	4.190E-34	1028	0.139	0.148	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
13	PDB:6yvuB	0.233	0.215	1.487E-32	1191	0.169	0.154	6yvuB.pdb.gz
14	PDB:6yvuA	0.290	0.282	6.982E-26	1127	0.165	0.160	6yvuA.pdb.gz
15	PDB:7tveD	0.315	0.736	2.405E-19	445	0.129	0.317	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
16	PDB:6wg3B	0.254	0.385	9.702E-17	693	0.125	0.196	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:6wg3A	0.224	0.416	2.334E-14	561	0.093	0.182	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:7ogtB	0.140	0.203	2.458E-14	708	0.090	0.138	7ogtB.pdb.gz
19	PDB:7ogtA	0.121	0.182	7.090E-13	688	0.075	0.119	7ogtA.pdb.gz
20	PDB:7tveE	0.244	0.547	1.620E-10	461	0.101	0.239	7tveE.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2S1ZR87	0.0	2254	1091	1.000	1.000	A0A2S1ZR87_HUMAN Structural maintenance of chromosomes 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=2 SV=1
2	C9JMN1	0.0	1465	740	0.654	0.965	C9JMN1_HUMAN Structural maintenance of chromosomes 6 (Fragment) OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=1
3	Q924W5	0.0	2060	1097	0.906	0.901	SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus OX=10090 GN=Smc6 PE=1 SV=1
4	Q96SB8	0.0	2254	1091	1.000	1.000	SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2
5	P53692	1.11e-121	403	1140	0.288	0.275	SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc6 PE=1 SV=1
6	Q9FLR5	2.26e-103	352	1058	0.270	0.279	SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana OX=3702 GN=SMC6A PE=2 SV=1
7	Q9VCB8	2.74e-100	344	1122	0.275	0.267	Q9VCB8_DROME Java no jive OS=Drosophila melanogaster OX=7227 GN=SMC6 PE=1 SV=1
8	Q9FII7	7.17e-98	336	1057	0.272	0.281	SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana OX=3702 GN=SMC6B PE=2 SV=1
9	Q12749	1.78e-90	317	1114	0.248	0.243	SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC6 PE=1 SV=1
10	G5EG17	1.33e-77	280	1149	0.267	0.253	SMC6_CAEEL Structural maintenance of chromosomes protein 6 homolog smc-6 OS=Caenorhabditis elegans OX=6239 GN=smc-6 PE=1 SV=1
11	Q9LFS8	1.85e-25	116	1053	0.217	0.225	SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana OX=3702 GN=SMC5 PE=2 SV=1
12	O13710	3.74e-25	115	1076	0.235	0.238	SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smc5 PE=1 SV=3
13	Q8T386	1.83e-12	74.3	1030	0.050	0.053	Q8T386_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=2 SV=1
14	Q08204	2.04e-12	74.3	1093	0.049	0.048	SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC5 PE=1 SV=1
15	Q8IY18	3.65e-12	73.6	1101	0.081	0.080	SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens OX=9606 GN=SMC5 PE=1 SV=2
16	M9PGC9	1.07e-11	71.6	1025	0.049	0.053	M9PGC9_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=1
17	Q9VP12	1.16e-11	71.6	992	0.049	0.054	Q9VP12_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=3
18	Q7YU66	1.18e-11	71.6	1034	0.049	0.052	Q7YU66_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=2 SV=1
19	Q7KTV9	1.25e-11	71.6	1001	0.049	0.054	Q7KTV9_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=2
20	Q8IPT2	1.26e-11	71.6	1034	0.049	0.052	Q8IPT2_DROME Structural maintenance of chromosomes protein 5 OS=Drosophila melanogaster OX=7227 GN=SMC5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	0.11	23.6	AAA ATPase domain
2	PF13304 AAA_21	37	15.6	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	2.2e-07	43.2	AAA domain
4	PF13555 AAA_29	44	15.3	P-loop containing region of AAA domain
5	PF13158 DUF3993	55	15.4	Protein of unknown function (DUF3993)
6	PF02463 SMC_N	7.8e-10	50.1	RecF/RecN/SMC N terminal domain
7	PF07926 TPR_MLP1_2	15	17.1	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287437	0.999	E3 SUMO-protein ligase NSE2
2	9606.ENSP00000330694	0.999	Non-structural maintenance of chromosomes element 3 homolog
3	9606.ENSP00000354957	0.999	Structural maintenance of chromosomes protein 5
4	9606.ENSP00000355077	0.999	Non-structural maintenance of chromosomes element 1 homolog
5	9606.ENSP00000358019	0.999	Non-structural maintenance of chromosomes element 4 homolog A
6	9606.ENSP00000435619	0.999	EP300-interacting inhibitor of differentiation 3
7	9606.ENSP00000354720	0.998	Structural maintenance of chromosomes protein 3
8	9606.ENSP00000297338	0.990	Double-strand-break repair protein rad21 homolog
9	9606.ENSP00000323421	0.983	Structural maintenance of chromosomes protein 1A
10	9606.ENSP00000384048	0.981	PAX-interacting protein 1
11	9606.ENSP00000349961	0.975	Structural maintenance of chromosomes protein 4
12	9606.ENSP00000218089	0.971	Cohesin subunit SA-2
13	9606.ENSP00000372689	0.970	Cohesin subunit SA-1
14	9606.ENSP00000348056	0.968	SUMO-conjugating enzyme UBC9
15	9606.ENSP00000376077	0.950	Small ubiquitin-related modifier 1
16	9606.ENSP00000318635	0.949	Small ubiquitin-related modifier 4
17	9606.ENSP00000365588	0.935	Mediator of DNA damage checkpoint protein 1
18	9606.ENSP00000286398	0.911	Structural maintenance of chromosomes protein 2
19	9606.ENSP00000372088	0.907	DNA repair protein RAD51 homolog 1
20	9606.ENSP00000411532	0.903	DNA topoisomerase 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.998	ubiquitin protein ligase binding
GO:0097159	0.980	organic cyclic compound binding
GO:1901363	0.979	heterocyclic compound binding
GO:0003676	0.960	nucleic acid binding
GO:0003824	0.951	catalytic activity
GO:0003677	0.894	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006974	0.996	cellular response to DNA damage stimulus
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0090304	0.995	nucleic acid metabolic process
GO:0006259	0.987	DNA metabolic process
GO:0050794	0.976	regulation of cellular process
GO:0016043	0.941	cellular component organization
GO:0006310	0.928	DNA recombination
GO:0051276	0.923	chromosome organization
GO:0048518	0.879	positive regulation of biological process
GO:0048522	0.838	positive regulation of cellular process
GO:0010564	0.738	regulation of cell cycle process
GO:0000723	0.558	telomere maintenance
GO:0006312	0.505	mitotic recombination
GO:0006281	0.487	DNA repair
GO:0045787	0.441	positive regulation of cell cycle
GO:0090068	0.424	positive regulation of cell cycle process
GO:0022402	0.397	cell cycle process
GO:0051984	0.393	positive regulation of chromosome segregation
GO:0000722	0.350	telomere maintenance via recombination
GO:0090398	0.320	cellular senescence

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005694	0.915	chromosome
GO:1902494	0.908	catalytic complex
GO:0098687	0.832	chromosomal region
GO:1990234	0.827	transferase complex
GO:0106068	0.728	SUMO ligase complex
GO:0005737	0.718	cytoplasm
GO:0000793	0.717	condensed chromosome
GO:0016604	0.681	nuclear body
GO:0016605	0.595	PML body
GO:0030915	0.517	Smc5-Smc6 complex
GO:0000781	0.486	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]