StarFunc result for job id Q96SF2

User Input

>input (557 residues)
MDSTVPSALELPQRLALNPRESPRSPEEEEPHLLSSLAAVQTLASVIRPCYGPHGRQKFL
VTMKGETVCTGCATAILRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAE
QLLKAGLPRPQLREAYATATAEVLATLPSLAIQSLGPLEDPSWALHSVMNTHTLSPMDHL
TKLVAHACWAIKELDGSFKPERVGVCALPGGTLEDSCLLPGLAISGKLCGQMATVLSGAR
VALFACPFGPAHPNAPATARLSSPADLAQFSKGSDQLLEKQVGQLAAAGINVAVVLGEVD
EETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPRLLPPQRPGKCQRVYRQELGDGLA
VVFEWECTGTPALTVVLRGATTQGLRSAEQAVYHGIDAYFQLCQDPRLIPGAGATEMALA
KMLSDKGSRLEGPSGPAFLAFAWALKYLPKTLAENAGLAVSDVMAEMSGVHQGGNLLMGV
GTEGIINVAQEGVWDTLIVKAQGFRAVAEVVLQLVTVDEIVVAKKSPTHQEIWNPDSKKT
KKHPPPVETKKILGLNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96SF2	1.000	1.000	1.186E-92	557	1.000	1.000	Q96SF2.pdb.gz	TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens OX=9606 GN=CCT8L2 PE=2 SV=2
2	AFDB:P42932	0.759	0.771	5.326E-46	548	0.298	0.303	P42932.pdb.gz	TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus OX=10090 GN=Cct8 PE=1 SV=3
3	AFDB:A0A0R4IJT8	0.764	0.763	7.834E-46	558	0.300	0.299	A0A0R4IJT8.pdb.gz	A0A0R4IJT8_DANRE T-complex protein 1 subunit theta OS=Danio rerio OX=7955 GN=fa22h09 PE=1 SV=1
4	PDB:7nvmQ	0.737	0.761	5.467E-44	538	0.291	0.301	7nvmQ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
5	AFDB:Q7K3J0	0.751	0.765	1.505E-43	546	0.280	0.286	Q7K3J0.pdb.gz	Q7K3J0_DROME T-complex protein 1 subunit theta OS=Drosophila melanogaster OX=7227 GN=CCT8 PE=1 SV=1
6	AFDB:Q38AE5	0.760	0.786	7.486E-42	537	0.259	0.268	Q38AE5.pdb.gz	Q38AE5_TRYB2 CCT-theta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2330 PE=3 SV=1
7	AFDB:P78921	0.776	0.790	1.228E-40	546	0.268	0.273	P78921.pdb.gz	TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct8 PE=2 SV=3
8	AFDB:Q94K05	0.750	0.760	6.644E-40	549	0.239	0.242	Q94K05.pdb.gz	TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana OX=3702 GN=CCT8 PE=1 SV=1
9	AFDB:Q5AB74	0.752	0.773	1.305E-39	540	0.248	0.256	Q5AB74.pdb.gz	Q5AB74_CANAL CCT-theta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCT8 PE=3 SV=1
10	AFDB:P47079	0.793	0.779	1.920E-39	568	0.266	0.261	P47079.pdb.gz	TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT8 PE=1 SV=1
11	AFDB:O96220	0.778	0.797	1.603E-38	542	0.203	0.208	O96220.pdb.gz	O96220_PLAF7 T-complex protein 1 subunit theta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214000 PE=3 SV=3
12	PDB:4b2tQ	0.753	0.863	4.115E-36	481	0.280	0.324	4b2tQ.pdb.gz
13	PDB:7nvme	0.668	0.687	6.352E-36	540	0.224	0.231	7nvme.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
14	PDB:7nvmD	0.710	0.754	1.588E-35	520	0.219	0.235	7nvmD.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
15	PDB:7nvmg	0.714	0.737	2.573E-35	538	0.217	0.225	7nvmg.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
16	PDB:7nvmA	0.728	0.753	5.055E-35	536	0.196	0.203	7nvmA.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
17	PDB:7nvnb	0.678	0.712	4.023E-34	527	0.217	0.230	7nvnb.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:6ks6b	0.677	0.723	1.480E-33	518	0.228	0.245	6ks6b.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
19	PDB:7nvmH	0.700	0.735	1.629E-33	528	0.206	0.218	7nvmH.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
20	PDB:6ks6Q	0.709	0.719	1.883E-33	548	0.262	0.266	6ks6Q.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96SF2	0.0	1127	557	1.000	1.000	TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens OX=9606 GN=CCT8L2 PE=2 SV=2
2	A0A0R4IJT8	4.93e-80	263	558	0.303	0.303	A0A0R4IJT8_DANRE T-complex protein 1 subunit theta OS=Danio rerio OX=7955 GN=fa22h09 PE=1 SV=1
3	Q7ZU96	5.25e-80	263	546	0.302	0.308	Q7ZU96_DANRE T-complex protein 1 subunit theta OS=Danio rerio OX=7955 GN=fa22h09 PE=1 SV=1
4	Q3ZCI9	2.12e-78	258	548	0.314	0.319	TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus OX=9913 GN=CCT8 PE=1 SV=3
5	P42932	1.94e-77	256	548	0.298	0.303	TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus OX=10090 GN=Cct8 PE=1 SV=3
6	P50990	7.02e-76	252	548	0.303	0.308	TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4
7	Q7K3J0	8.95e-71	238	546	0.293	0.299	Q7K3J0_DROME T-complex protein 1 subunit theta OS=Drosophila melanogaster OX=7227 GN=CCT8 PE=1 SV=1
8	P78921	2.78e-66	226	546	0.280	0.286	TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct8 PE=2 SV=3
9	P47079	9.00e-57	201	568	0.276	0.271	TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT8 PE=1 SV=1
10	Q5AB74	1.68e-56	200	540	0.242	0.250	Q5AB74_CANAL CCT-theta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCT8 PE=3 SV=1
11	Q94K05	2.78e-54	194	549	0.237	0.240	TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana OX=3702 GN=CCT8 PE=1 SV=1
12	Q38AE5	1.82e-53	192	537	0.257	0.266	Q38AE5_TRYB2 CCT-theta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2330 PE=3 SV=1
13	Q877G8	4.04e-50	183	543	0.235	0.241	Q877G8_METMI Chaperonin OS=Methanococcus maripaludis OX=39152 PE=1 SV=1
14	Q8JHI7	8.62e-45	168	543	0.251	0.258	Q8JHI7_DANRE T-complex protein 1 subunit gamma OS=Danio rerio OX=7955 GN=wu:fj48b06 PE=1 SV=1
15	P47209	1.03e-44	168	542	0.232	0.238	TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans OX=6239 GN=cct-5 PE=2 SV=1
16	Q9V2S9	2.36e-42	161	559	0.233	0.233	THSA_SACS2 Thermosome subunit alpha OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=thsA PE=1 SV=2
17	Q382B2	2.46e-42	161	538	0.235	0.243	Q382B2_TRYB2 T-complex protein 1 subunit epsilon OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5860 PE=3 SV=1
18	O96220	3.72e-42	160	542	0.219	0.225	O96220_PLAF7 T-complex protein 1 subunit theta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214000 PE=3 SV=3
19	Q6NVI6	1.15e-41	159	541	0.251	0.259	Q6NVI6_DANRE T-complex protein 1 subunit epsilon OS=Danio rerio OX=7955 GN=CCT5 PE=1 SV=1
20	Q3T0K2	2.99e-41	158	545	0.244	0.250	TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus OX=9913 GN=CCT3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00118 Cpn60_TCP1	3.5e-98	341.0	TCP-1/cpn60 chaperonin family
2	PF14748 P5CR_dimer	93	14.8	Pyrroline-5-carboxylate reductase dimerisation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353048

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376946	0.998	Bardet-Biedl syndrome 10 protein
2	9606.ENSP00000377958	0.978	T-complex protein 1 subunit delta
3	9606.ENSP00000258091	0.977	T-complex protein 1 subunit eta
4	9606.ENSP00000295688	0.976	T-complex protein 1 subunit gamma
5	9606.ENSP00000299300	0.975	T-complex protein 1 subunit beta
6	9606.ENSP00000280326	0.944	T-complex protein 1 subunit epsilon
7	9606.ENSP00000246062	0.932	McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin
8	9606.ENSP00000275603	0.923	T-complex protein 1 subunit zeta
9	9606.ENSP00000327191	0.923	T-complex protein 1 subunit zeta-2
10	9606.ENSP00000317334	0.913	T-complex protein 1 subunit alpha
11	9606.ENSP00000403077	0.848	Vitamin K epoxide reductase complex subunit 1 like 1
12	9606.ENSP00000438273	0.753	Bardet-Biedl syndrome 12 protein
13	9606.ENSP00000264380	0.706	1-phosphatidylinositol 3-phosphate 5-kinase
14	9606.ENSP00000342448	0.663	Olfactory receptor 5W2
15	9606.ENSP00000360609	0.647	Heat shock protein HSP 90-beta
16	9606.ENSP00000432083	0.638	Heat shock cognate 71 kDa protein
17	9606.ENSP00000474534	0.626	HSPE1-MOB4 readthrough
18	9606.ENSP00000351646	0.601	Stress-induced-phosphoprotein 1
19	9606.ENSP00000252835	0.600	Olfactory receptor 11H1
20	9606.ENSP00000325919	0.599	Proteasome assembly chaperone 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005227	0.992	calcium activated cation channel activity
GO:0015079	0.990	potassium ion transmembrane transporter activity
GO:0005261	0.850	monoatomic cation channel activity
GO:0008509	0.830	monoatomic anion transmembrane transporter activity
GO:0005267	0.782	potassium channel activity
GO:0015269	0.770	calcium-activated potassium channel activity
GO:0005253	0.722	monoatomic anion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.905	regulation of biological process
GO:0050794	0.833	regulation of cellular process
GO:0019222	0.394	regulation of metabolic process
GO:0071840	0.366	cellular component organization or biogenesis
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0048518	0.308	positive regulation of biological process
GO:0080090	0.303	regulation of primary metabolic process
GO:0051171	0.303	regulation of nitrogen compound metabolic process
GO:0031323	0.303	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.993	organelle
GO:0043229	0.978	intracellular organelle
GO:0032991	0.972	protein-containing complex
GO:0043227	0.958	membrane-bounded organelle
GO:0043228	0.955	non-membrane-bounded organelle
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0140535	0.890	intracellular protein-containing complex
GO:0043231	0.755	intracellular membrane-bounded organelle
GO:0005856	0.662	cytoskeleton
GO:0005634	0.578	nucleus
GO:0101031	0.562	chaperone complex
GO:0015630	0.354	microtubule cytoskeleton
GO:0005832	0.306	chaperonin-containing T-complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.990	K(+)(in) = K(+)(out)

[back to server]