StarFunc result for job id Q96SF7

User Input

>input (602 residues)
MSERRRSAVALSSRAHAFSVEALIGSNKKRKLRDWEEKGLDLSMEALSPAGPLGDTEDAA
AHGLEPHPDSEQSTGSDSEVLTERTSCSFSTHTDLASGAAGPVPAAMSSMEEIQVELQCA
DLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSS
KWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKY
QPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAK
GFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPS
ASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSG
YNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYV
MQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQS
TLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH
MV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70306	0.505	0.505	5.924E-92	602	0.987	0.987	O70306.pdb.gz	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
2	AFDB:P70323	0.306	0.384	1.652E-34	479	0.251	0.315	P70323.pdb.gz	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
3	AFDB:O43435	0.310	0.464	1.410E-33	398	0.252	0.382	O43435.pdb.gz	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
4	AFDB:O75333	0.306	0.476	2.714E-33	385	0.249	0.390	O75333.pdb.gz	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
5	AFDB:A0A1D5NXF3	0.320	0.266	5.023E-32	732	0.292	0.240	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
6	AFDB:A2RUW2	0.321	0.283	7.621E-32	689	0.272	0.238	A2RUW2.pdb.gz
7	AFDB:Q13207	0.350	0.299	6.127E-31	712	0.291	0.246	Q13207.pdb.gz	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
8	AFDB:Q7ZTU9	0.327	0.289	1.112E-30	687	0.286	0.250	Q7ZTU9.pdb.gz	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
9	AFDB:O15119	0.307	0.253	2.140E-30	743	0.271	0.219	O15119.pdb.gz	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
10	AFDB:P90971	0.310	0.533	6.252E-30	346	0.206	0.358	P90971.pdb.gz	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
11	PDB:7b0xC	0.103	0.219	1.618E-2	211	0.033	0.095	7b0xC.pdb.gz
12	PDB:7ea3J	0.095	0.069	2.455E-2	883	0.032	0.022	7ea3J.pdb.gz
13	PDB:7tysA	0.069	0.098	4.453E-2	361	0.037	0.061	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
14	PDB:1ezvX	0.109	0.329	5.650E-2	127	0.038	0.181	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
15	PDB:7bw8C	0.079	0.234	7.610E-2	138	0.038	0.167	7bw8C.pdb.gz
16	PDB:3fxiC	0.101	0.280	9.657E-2	140	0.033	0.143	3fxiC.pdb.gz
17	PDB:3hlkB	0.100	0.136	9.657E-2	411	0.035	0.051	3hlkB.pdb.gz
18	PDB:3jcmN	0.106	0.042	1.025E-1	1686	0.023	0.008	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:2r77A	0.094	0.225	1.155E-1	190	0.025	0.079	2r77A.pdb.gz
20	PDB:3apnA	0.099	0.104	1.301E-1	563	0.035	0.037	3apnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70306	0.0	1239	602	0.987	0.987	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
2	O95935	0.0	588	607	0.576	0.572	TBX18_HUMAN T-box transcription factor TBX18 OS=Homo sapiens OX=9606 GN=TBX18 PE=1 SV=3
3	Q8JFF9	0.0	540	554	0.548	0.596	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
4	Q96SF7	0.0	1253	602	1.000	1.000	TBX15_HUMAN T-box transcription factor TBX15 OS=Homo sapiens OX=9606 GN=TBX15 PE=1 SV=2
5	Q9EPZ6	0.0	590	613	0.576	0.566	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
6	Q9Y458	2.00e-123	376	520	0.424	0.490	TBX22_HUMAN T-box transcription factor TBX22 OS=Homo sapiens OX=9606 GN=TBX22 PE=1 SV=3
7	Q8UW76	3.18e-100	313	440	0.286	0.391	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
8	Q9ES03	1.78e-96	304	445	0.276	0.373	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
9	Q9UMR3	3.81e-95	300	447	0.272	0.367	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
10	Q8AXW8	6.91e-94	297	441	0.271	0.370	TBX20_XENLA T-box transcription factor TBX20 OS=Xenopus laevis OX=8355 GN=tbx20 PE=2 SV=1
11	Q9I9K7	1.48e-91	291	446	0.261	0.352	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
12	Q8AX98	1.15e-75	250	463	0.211	0.274	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
13	O43435	1.30e-75	248	398	0.206	0.312	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
14	Q8AXX2	2.46e-75	249	460	0.208	0.272	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
15	Q9VMR2	1.14e-74	251	580	0.199	0.207	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
16	Q8SYY8	3.14e-74	249	571	0.194	0.205	Q8SYY8_DROME RE27439p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
17	Q9W3F4	4.26e-74	252	699	0.201	0.173	Q9W3F4_DROME Optomotor-blind-related-gene-1, isoform A OS=Drosophila melanogaster OX=7227 GN=org-1 PE=4 SV=1
18	O62535	4.81e-74	252	712	0.201	0.170	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
19	P70323	9.33e-74	246	479	0.218	0.273	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
20	O75333	3.07e-73	241	385	0.188	0.294	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	2.4e-72	254.3	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013139

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002183	0.713	Homeobox A5
2	9593.ENSGGOP00000025052	0.679	SET domain containing 2
3	9593.ENSGGOP00000027431	0.629	Nipped-B homolog (Drosophila)
4	9593.ENSGGOP00000006756	0.603	Ganglioside induced differentiation associated protein 2
5	9593.ENSGGOP00000000591	0.592	Paired related homeobox 2
6	9593.ENSGGOP00000018665	0.589	Uncharacterized protein
7	9593.ENSGGOP00000028255	0.588	Protein Wnt
8	9593.ENSGGOP00000014420	0.575	Natural killer cell granule protein 7
9	9593.ENSGGOP00000005505	0.572	Protein phosphatase 1, regulatory subunit 3A
10	9593.ENSGGOP00000017439	0.569	Short stature homeobox 2
11	9593.ENSGGOP00000007379	0.557	Transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
12	9593.ENSGGOP00000013913	0.556	ALX homeobox 4
13	9593.ENSGGOP00000008411	0.551	SIX homeobox 2
14	9593.ENSGGOP00000014668	0.544	Tryptophanyl tRNA synthetase 2, mitochondrial
15	9593.ENSGGOP00000025437	0.540	ALX homeobox 1
16	9593.ENSGGOP00000012076	0.532	Uncharacterized protein
17	9593.ENSGGOP00000001261	0.525	Solute carrier family 16, member 11
18	9593.ENSGGOP00000016680	0.518	NK2 homeobox 5
19	9593.ENSGGOP00000009778	0.517	SIX homeobox 4
20	9593.ENSGGOP00000012209	0.511	Ladybird homeobox 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.895	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0046983	0.833	protein dimerization activity
GO:0042802	0.829	identical protein binding
GO:0042803	0.783	protein homodimerization activity
GO:0001227	0.732	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.993	multicellular organism development
GO:0080090	0.988	regulation of primary metabolic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.971	regulation of RNA metabolic process
GO:0009790	0.968	embryo development
GO:0048731	0.956	system development
GO:2001141	0.955	regulation of RNA biosynthetic process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0048513	0.935	animal organ development
GO:0048598	0.927	embryonic morphogenesis
GO:0048568	0.913	embryonic organ development
GO:0006357	0.894	regulation of transcription by RNA polymerase II
GO:0009887	0.892	animal organ morphogenesis
GO:0009987	0.888	cellular process
GO:0048519	0.843	negative regulation of biological process
GO:0009888	0.647	tissue development
GO:0043009	0.634	chordate embryonic development
GO:0048523	0.633	negative regulation of cellular process
GO:0048705	0.625	skeletal system morphogenesis
GO:0048704	0.622	embryonic skeletal system morphogenesis
GO:0035295	0.618	tube development
GO:0045934	0.610	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.603	negative regulation of RNA metabolic process
GO:0010558	0.500	negative regulation of macromolecule biosynthetic process
GO:0048701	0.497	embryonic cranial skeleton morphogenesis
GO:1903507	0.487	negative regulation of nucleic acid-templated transcription
GO:0048518	0.476	positive regulation of biological process
GO:0072359	0.445	circulatory system development
GO:0048522	0.432	positive regulation of cellular process
GO:0045892	0.420	negative regulation of DNA-templated transcription
GO:0010604	0.406	positive regulation of macromolecule metabolic process
GO:0030154	0.373	cell differentiation
GO:0031325	0.369	positive regulation of cellular metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0007399	0.334	nervous system development
GO:0051173	0.321	positive regulation of nitrogen compound metabolic process
GO:0060429	0.310	epithelium development
GO:0035239	0.309	tube morphogenesis
GO:0010557	0.304	positive regulation of macromolecule biosynthetic process
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.978	protein-containing complex
GO:0031981	0.961	nuclear lumen
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005667	0.920	transcription regulator complex
GO:0005694	0.863	chromosome
GO:0000785	0.838	chromatin
GO:0140513	0.331	nuclear protein-containing complex
GO:0005654	0.330	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]