StarFunc result for job id Q96SI1

User Input

>input (283 residues)
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K0E1	0.900	0.900	8.938E-54	283	0.975	0.975	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
2	AFDB:Q5XJ34	0.828	0.908	1.994E-46	257	0.802	0.883	Q5XJ34.pdb.gz	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
3	AFDB:A0A2U3U043	0.752	0.267	5.510E-43	865	0.739	0.242	A0A2U3U043.pdb.gz	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
4	AFDB:D5SHR0	0.420	0.326	1.450E-30	367	0.456	0.351	D5SHR0.pdb.gz	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
5	AFDB:Q8NC69	0.328	0.391	1.050E-17	237	0.226	0.270	Q8NC69.pdb.gz	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
6	AFDB:Q9VDH3	0.329	0.405	5.910E-17	228	0.233	0.289	Q9VDH3.pdb.gz	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
7	AFDB:Q50H33	0.389	0.247	1.162E-15	476	0.279	0.166	Q50H33.pdb.gz	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
8	AFDB:Q68DU8	0.407	0.288	1.475E-15	428	0.272	0.180	Q68DU8.pdb.gz	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
9	AFDB:Q804Q4	0.356	0.350	3.397E-15	288	0.233	0.229	Q804Q4.pdb.gz	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
10	AFDB:Q4G0X4	0.380	0.410	3.605E-15	260	0.254	0.277	Q4G0X4.pdb.gz	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
11	PDB:6sgaFS	0.341	0.347	4.383E-11	277	0.170	0.173	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
12	PDB:7w6sB	0.304	0.200	2.475E-7	448	0.131	0.083	7w6sB.pdb.gz
13	PDB:7phhA	0.265	0.192	1.570E-6	396	0.092	0.066	7phhA.pdb.gz
14	PDB:7sizB	0.280	0.239	1.666E-6	334	0.081	0.069	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
15	PDB:3lutB	0.299	0.222	2.848E-6	390	0.081	0.059	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	PDB:2a79B	0.299	0.324	3.836E-6	259	0.081	0.089	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
17	PDB:7f3fA	0.300	0.193	6.558E-6	460	0.131	0.080	7f3fA.pdb.gz
18	PDB:7sszA	0.283	0.225	3.276E-5	362	0.081	0.064	7sszA.pdb.gz
19	PDB:7pquA	0.275	0.239	4.158E-5	328	0.085	0.073	7pquA.pdb.gz
20	PDB:6wcqC	0.273	0.540	5.504E-3	130	0.053	0.115	6wcqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K0E1	0.0	577	283	0.975	0.975	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
2	Q96SI1	0.0	586	283	1.000	1.000	KCD15_HUMAN BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens OX=9606 GN=KCTD15 PE=1 SV=1
3	Q6DC02	8.78e-178	492	257	0.823	0.907	KCD15_DANRE BTB/POZ domain-containing protein kctd15 OS=Danio rerio OX=7955 GN=kctd15 PE=1 SV=1
4	Q5XJ34	1.46e-173	481	257	0.802	0.883	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
5	Q719H9	1.47e-154	433	257	0.724	0.798	KCTD1_HUMAN BTB/POZ domain-containing protein KCTD1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
6	A0A2U3U043	1.03e-147	437	865	0.728	0.238	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
7	D5SHR0	1.67e-78	244	367	0.438	0.338	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
8	Q4G0X4	4.46e-27	107	260	0.177	0.192	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
9	Q8NC69	2.90e-22	94.4	237	0.187	0.224	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
10	Q8WVF5	3.97e-22	94.7	259	0.159	0.174	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2
11	Q9VDH3	9.11e-19	84.7	228	0.237	0.294	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
12	Q561T3	1.52e-16	79.7	271	0.258	0.269	Q561T3_DANRE Potassium channel tetramerisation domain-containing 12.2 OS=Danio rerio OX=7955 GN=ron PE=1 SV=2
13	Q8N5I3	1.13e-15	77.0	272	0.124	0.129	KCNRG_HUMAN Potassium channel regulatory protein OS=Homo sapiens OX=9606 GN=KCNRG PE=1 SV=1
14	Q50H33	2.06e-15	78.2	476	0.180	0.107	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
15	Q96CX2	3.50e-15	76.6	325	0.141	0.123	KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1
16	Q6WVG3	5.51e-15	75.9	327	0.141	0.122	KCD12_MOUSE BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1
17	Q8C7J6	1.40e-13	71.6	292	0.120	0.116	Q8C7J6_MOUSE Potassium channel tetramerisation domain containing 12b OS=Mus musculus OX=10090 GN=Kctd12b PE=1 SV=1
18	Q6ZWB6	2.56e-13	71.6	473	0.138	0.082	KCTD8_HUMAN BTB/POZ domain-containing protein KCTD8 OS=Homo sapiens OX=9606 GN=KCTD8 PE=1 SV=1
19	Q804Q4	3.34e-13	70.5	288	0.134	0.132	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
20	Q8BJK1	4.42e-13	70.1	289	0.166	0.163	KCTD7_MOUSE BTB/POZ domain-containing protein KCTD7 OS=Mus musculus OX=10090 GN=Kctd7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	6.5e-13	60.2	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000018504

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010583	0.847	Transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
2	9598.ENSPTRP00000031214	0.808	Transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
3	9598.ENSPTRP00000055733	0.799	Transmembrane protein 18
4	9598.ENSPTRP00000027571	0.795	Glucosamine-6-phosphate deaminase 2
5	9598.ENSPTRP00000053639	0.791	SH2B adaptor protein 1
6	9598.ENSPTRP00000001490	0.778	Neuronal growth regulator 1
7	9598.ENSPTRP00000006211	0.776	Uncharacterized protein
8	9598.ENSPTRP00000023487	0.761	Uncharacterized protein
9	9598.ENSPTRP00000000923	0.732	Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
10	9598.ENSPTRP00000008400	0.663	Uncharacterized protein
11	9598.ENSPTRP00000040332	0.654	Fat mass and obesity associated
12	9598.ENSPTRP00000017101	0.646	Uncharacterized protein
13	9598.ENSPTRP00000031212	0.595	Transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
14	9598.ENSPTRP00000052558	0.585	Uncharacterized protein
15	9598.ENSPTRP00000027028	0.566	Uncharacterized protein
16	9598.ENSPTRP00000031150	0.555	Uncharacterized protein
17	9598.ENSPTRP00000013085	0.551	Potassium channel tetramerization domain containing 5
18	9598.ENSPTRP00000020384	0.551	Thyroid adenoma associated
19	9598.ENSPTRP00000020326	0.542	CCAAT/enhancer binding protein (C/EBP), zeta
20	9598.ENSPTRP00000008398	0.540	BCDIN3 domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0050896	0.877	response to stimulus
GO:0048856	0.798	anatomical structure development
GO:0032501	0.795	multicellular organismal process
GO:0051716	0.794	cellular response to stimulus
GO:0007154	0.789	cell communication
GO:0007166	0.765	cell surface receptor signaling pathway
GO:0007275	0.644	multicellular organism development
GO:0007267	0.567	cell-cell signaling
GO:0009790	0.560	embryo development
GO:0019222	0.527	regulation of metabolic process
GO:0198738	0.525	cell-cell signaling by wnt
GO:0060255	0.505	regulation of macromolecule metabolic process
GO:0080090	0.481	regulation of primary metabolic process
GO:0051171	0.437	regulation of nitrogen compound metabolic process
GO:0031323	0.382	regulation of cellular metabolic process
GO:0010468	0.382	regulation of gene expression
GO:0019219	0.371	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.367	negative regulation of biological process
GO:0051252	0.349	regulation of RNA metabolic process
GO:0048523	0.344	negative regulation of cellular process
GO:0048518	0.333	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.966	nuclear lumen
GO:0005654	0.933	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]