StarFunc result for job id Q96SL4

User Input

>input (187 residues)
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96SL4	1.000	1.000	5.547E-42	187	1.000	1.000	Q96SL4.pdb.gz	GPX7_HUMAN Glutathione peroxidase 7 OS=Homo sapiens OX=9606 GN=GPX7 PE=1 SV=1
2	PDB:2p31A	0.815	0.982	5.414E-33	155	0.818	0.987	2p31A.pdb.gz
3	AFDB:Q8TED1	0.876	0.786	7.114E-29	209	0.492	0.440	Q8TED1.pdb.gz	GPX8_HUMAN Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2
4	AFDB:Q9SZ54	0.852	0.688	1.183E-23	233	0.380	0.305	Q9SZ54.pdb.gz	GPX7_ARATH Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPX7 PE=3 SV=2
5	AFDB:P52032	0.873	0.696	1.974E-23	236	0.358	0.284	P52032.pdb.gz	GPX1_ARATH Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPX1 PE=2 SV=2
6	AFDB:O48646	0.818	0.661	2.549E-23	232	0.364	0.293	O48646.pdb.gz	GPX6_ARATH Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPX6 PE=2 SV=2
7	AFDB:Q6ESJ0	0.816	0.643	9.762E-23	238	0.364	0.286	Q6ESJ0.pdb.gz	Q6ESJ0_ORYSJ Glutathione peroxidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0664000 PE=1 SV=1
8	AFDB:O22850	0.823	0.748	5.850E-22	206	0.342	0.311	O22850.pdb.gz	GPX3_ARATH Probable glutathione peroxidase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPX3 PE=1 SV=1
9	AFDB:C8VJD9	0.822	0.551	1.040E-21	282	0.348	0.230	C8VJD9.pdb.gz	C8VJD9_EMENI Glutathione peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02846 PE=3 SV=1
10	AFDB:P38143	0.802	0.923	2.102E-21	162	0.316	0.364	P38143.pdb.gz	GPX2_YEAST Glutathione peroxidase-like peroxiredoxin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPX2 PE=1 SV=1
11	AFDB:Q9LYB4	0.807	0.871	2.241E-21	173	0.337	0.364	Q9LYB4.pdb.gz	GPX5_ARATH Probable glutathione peroxidase 5 OS=Arabidopsis thaliana OX=3702 GN=GPX5 PE=1 SV=1
12	PDB:2f8aA	0.771	0.775	6.505E-18	186	0.342	0.344	2f8aA.pdb.gz
13	PDB:2i3yA	0.768	0.764	6.505E-18	188	0.326	0.324	2i3yA.pdb.gz
14	PDB:2he3A	0.766	0.774	1.929E-17	185	0.299	0.303	2he3A.pdb.gz
15	PDB:2r37A	0.761	0.746	1.232E-16	191	0.316	0.309	2r37A.pdb.gz
16	PDB:3cmiA	0.673	0.871	1.232E-15	143	0.267	0.350	3cmiA.pdb.gz
17	PDB:2rm5A	0.664	0.738	8.932E-13	167	0.299	0.335	2rm5A.pdb.gz
18	PDB:3iosA	0.566	0.760	2.181E-7	134	0.128	0.179	3iosA.pdb.gz
19	PDB:3sbcB	0.518	0.496	2.475E-5	197	0.139	0.132	3sbcB.pdb.gz
20	PDB:1xvwB	0.495	0.559	3.197E-5	160	0.182	0.212	1xvwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96SL4	1.73e-140	390	187	1.000	1.000	GPX7_HUMAN Glutathione peroxidase 7 OS=Homo sapiens OX=9606 GN=GPX7 PE=1 SV=1
2	Q8TED1	2.22e-69	211	209	0.492	0.440	GPX8_HUMAN Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2
3	O48646	5.17e-39	135	232	0.353	0.284	GPX6_ARATH Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPX6 PE=2 SV=2
4	Q6JAH6	1.32e-37	129	168	0.342	0.381	Q6JAH6_MAIZE Glutathione peroxidase OS=Zea mays OX=4577 GN=100273297 PE=2 SV=1
5	Q9SZ54	4.36e-37	130	233	0.369	0.296	GPX7_ARATH Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPX7 PE=3 SV=2
6	P52032	1.27e-36	129	236	0.358	0.284	GPX1_ARATH Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPX1 PE=2 SV=2
7	O04922	3.30e-36	125	169	0.332	0.367	GPX2_ARATH Probable glutathione peroxidase 2 OS=Arabidopsis thaliana OX=3702 GN=GPX2 PE=1 SV=1
8	Q6ESJ0	1.29e-35	126	238	0.364	0.286	Q6ESJ0_ORYSJ Glutathione peroxidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0664000 PE=1 SV=1
9	C8VJD9	3.96e-35	126	282	0.348	0.230	C8VJD9_EMENI Glutathione peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02846 PE=3 SV=1
10	P36970	5.10e-35	124	197	0.358	0.340	GPX4_RAT Phospholipid hydroperoxide glutathione peroxidase OS=Rattus norvegicus OX=10116 GN=Gpx4 PE=1 SV=3
11	O22850	7.16e-35	123	206	0.342	0.311	GPX3_ARATH Probable glutathione peroxidase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GPX3 PE=1 SV=1
12	P36969	1.01e-34	123	197	0.364	0.345	GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX4 PE=1 SV=3
13	O70325	1.32e-34	122	197	0.358	0.340	GPX4_MOUSE Phospholipid hydroperoxide glutathione peroxidase OS=Mus musculus OX=10090 GN=Gpx4 PE=1 SV=4
14	P38143	3.14e-34	120	162	0.332	0.383	GPX2_YEAST Glutathione peroxidase-like peroxiredoxin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPX2 PE=1 SV=1
15	P06610	9.59e-34	120	183	0.342	0.350	BTUE_ECOLI Thioredoxin/glutathione peroxidase BtuE OS=Escherichia coli (strain K12) OX=83333 GN=btuE PE=1 SV=1
16	P36968	9.71e-34	120	197	0.369	0.350	GPX4_PIG Phospholipid hydroperoxide glutathione peroxidase OS=Sus scrofa OX=9823 GN=GPX4 PE=1 SV=3
17	Q9LYB4	1.41e-33	119	173	0.348	0.376	GPX5_ARATH Probable glutathione peroxidase 5 OS=Arabidopsis thaliana OX=3702 GN=GPX5 PE=1 SV=1
18	O02621	1.35e-32	116	163	0.332	0.380	GPX1_CAEEL Glutathione peroxidase 1 OS=Caenorhabditis elegans OX=6239 GN=gpx-1 PE=3 SV=1
19	Q8L910	5.05e-32	115	170	0.310	0.341	GPX4_ARATH Probable glutathione peroxidase 4 OS=Arabidopsis thaliana OX=3702 GN=GPX4 PE=2 SV=1
20	P40581	6.21e-32	114	163	0.321	0.368	GPX3_YEAST Glutathione peroxidase-like peroxiredoxin HYR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HYR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12806 Acyl-CoA_dh_C	84	14.8	Acetyl-CoA dehydrogenase C-terminal like
2	PF00578 AhpC-TSA	0.072	24.4	AhpC/TSA family
3	PF00255 GSHPx	3.9e-35	131.1	Glutathione peroxidase
4	PF08534 Redoxin	5.2e+02	11.8	Redoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221130	0.987	Glutathione reductase, mitochondrial
2	9606.ENSP00000327801	0.980	Protein disulfide-isomerase
3	9606.ENSP00000270142	0.970	Superoxide dismutase [Cu-Zn]
4	9606.ENSP00000446252	0.964	Superoxide dismutase [Mn], mitochondrial
5	9606.ENSP00000371554	0.959	Extracellular superoxide dismutase [Cu-Zn]
6	9606.ENSP00000216951	0.945	Glutathione synthetase
7	9606.ENSP00000379042	0.935	ERO1-like protein alpha
8	9606.ENSP00000241052	0.910	Catalase
9	9606.ENSP00000363512	0.909	Arachidonate 5-lipoxygenase
10	9606.ENSP00000256594	0.896	Glutathione S-transferase Mu 3
11	9606.ENSP00000360002	0.893	Glutathione S-transferase A4
12	9606.ENSP00000241337	0.889	Glutathione S-transferase Mu 2
13	9606.ENSP00000324173	0.881	78 kDa glucose-regulated protein
14	9606.ENSP00000358851	0.879	Glutathione S-transferase Mu 4
15	9606.ENSP00000256593	0.847	Glutathione S-transferase Mu 5
16	9606.ENSP00000311469	0.846	Glutathione S-transferase Mu 1
17	9606.ENSP00000264867	0.840	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
18	9606.ENSP00000211122	0.816	Glutathione S-transferase A3
19	9606.ENSP00000434516	0.801	Thioredoxin reductase 1, cytoplasmic
20	9606.ENSP00000295256	0.799	Hematopoietic prostaglandin D synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004601	1.000	peroxidase activity
GO:0004096	0.991	catalase activity
GO:0004602	0.861	glutathione peroxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0051716	0.960	cellular response to stimulus
GO:0042221	0.950	response to chemical
GO:0006950	0.931	response to stress
GO:0070887	0.908	cellular response to chemical stimulus
GO:0006979	0.903	response to oxidative stress
GO:0034599	0.862	cellular response to oxidative stress
GO:0008152	0.810	metabolic process
GO:0071704	0.784	organic substance metabolic process
GO:0044237	0.615	cellular metabolic process
GO:0065007	0.488	biological regulation
GO:0050789	0.414	regulation of biological process
GO:0050794	0.339	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031974	0.999	membrane-enclosed lumen
GO:0070013	0.986	intracellular organelle lumen
GO:0005783	0.969	endoplasmic reticulum
GO:0005829	0.926	cytosol
GO:0005576	0.900	extracellular region
GO:0031982	0.865	vesicle
GO:0005788	0.725	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.11.1.-	1.000	Peroxidases.
RHEA:20309	0.991	2 H2O2 = 2 H2O + O2
EC:1.11.1.6	0.991	catalase.
RHEA:16833	0.861	2 glutathione + H2O2 = glutathione disulfide + 2 H2O
EC:1.11.1.9	0.861	glutathione peroxidase.

[back to server]