StarFunc result for job id Q96SN8

User Input

>input (1893 residues)
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNM
KDFENQITELKKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRELQER
EQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCL
KEEKSQMACPDENVSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLR
EKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEK
DLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLSESNKKLHNQEQVIK
HLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIF
SKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLS
YQNLRKTLEEQISEIRRREEESFSLYSDQTSYLSICLEENNRFQVEHFSQEELKKKVSDL
IQLVKELYTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDE
INFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEEGAFINLLAPL
FNEKATLLLESRPDLLKVVRELLLGQLFLTEQEVSGEHLDGKTEKTPKQKGELVHFVQTN
SFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPIN
TALSAEHRPENLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMYRLPATQEV
VTQLQSQILELQGELKEFKTCNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDS
PGEQKGIKTTSSVWRDKEMDSDQQRSYEIDSEICPPDDLASLPSCKENPEDVLSPTSVAT
YLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLETELEGYQNFIFQLQKHSQCS
EAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLAPEMIDSRVLE
NLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQI
KDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGK
SVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNET
EKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFAS
GSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYAS
VKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEEVKLRQQLLSQNDKLLQSLRVE
LKAYEKLDEEHRRLREASGEGWKGQDPFRDLHSLLMEIQALRLQLERSIETSSTLQSRLK
EQLARGAEKAQEGALTLAVQAVSIPEVPLQPDKHDGDKYPMESDNSFDLFDSSQAVTPKS
VSETPPLSGNDTDSLSCDSGSSATSTPCVSRLVTGHHLWASKNGRHVLGLIEDYEALLKQ
ISQGQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLL
WRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQL
VVTHKILRKARGNLELRPGGAHPGTCSPSRPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K389	0.156	0.161	0.000	1822	0.676	0.703	Q8K389.pdb.gz	CK5P2_MOUSE CDK5 regulatory subunit-associated protein 2 OS=Mus musculus OX=10090 GN=Cdk5rap2 PE=1 SV=3
2	AFDB:Q96SN8	1.000	1.000	0.000	1893	1.000	1.000	Q96SN8.pdb.gz	CK5P2_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=5
3	AFDB:Q9JLH5	0.210	0.209	0.000	1903	0.707	0.704	Q9JLH5.pdb.gz	CK5P2_RAT CDK5 regulatory subunit-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cdk5rap2 PE=1 SV=2
4	AFDB:Q5VU43	0.101	0.084	8.585E-30	2346	0.265	0.214	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
5	AFDB:Q80YT7	0.075	0.066	1.892E-26	2224	0.253	0.215	Q80YT7.pdb.gz	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
6	AFDB:Q9WUJ3	0.121	0.101	1.076E-25	2324	0.241	0.197	Q9WUJ3.pdb.gz	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
7	AFDB:Q86UU1	0.039	0.052	1.157E-5	1377	0.099	0.137	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
8	AFDB:F4HRT5	0.068	0.108	1.766E-3	1132	0.094	0.157	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
9	AFDB:Q0DY81	0.061	0.092	2.264E-3	1155	0.095	0.156	Q0DY81.pdb.gz	NMCPA_ORYSJ Nuclear matrix constituent protein 1a OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1A PE=2 SV=1
10	AFDB:Q5M9N0	0.073	0.113	2.409E-3	1113	0.084	0.143	Q5M9N0.pdb.gz	CD158_HUMAN Coiled-coil domain-containing protein 158 OS=Homo sapiens OX=9606 GN=CCDC158 PE=1 SV=2
11	PDB:4h63H	0.030	0.234	6.612E-2	174	0.013	0.138	4h63H.pdb.gz
12	PDB:5n9jU	0.030	0.205	1.900E-1	198	0.014	0.131	5n9jU.pdb.gz
13	PDB:7lbmh	0.029	0.319	4.001E-1	158	0.010	0.120	7lbmh.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:1wleB	0.035	0.131	1.015	469	0.004	0.015	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
15	PDB:2q0oD	0.033	0.599	1.015	87	0.008	0.172	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
16	PDB:5oqmk	0.034	0.374	1.301	127	0.009	0.134	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
17	PDB:7emfK	0.040	0.304	1.301	112	0.009	0.152	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:2zdiB	0.031	0.369	1.474	106	0.007	0.123	2zdiB.pdb.gz
19	PDB:6eznE	0.033	0.585	1.568	85	0.004	0.094	6eznE.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
20	PDB:4gwpD	0.034	0.369	1.668	121	0.009	0.140	4gwpD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRG9	0.0	1385	1663	0.370	0.422	A0A0A0MRG9_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
2	B1AMJ5	0.0	2632	1287	0.680	1.000	B1AMJ5_HUMAN CDK5 regulatory subunit-associated protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
3	Q5JTU8	0.0	1830	903	0.477	1.000	Q5JTU8_HUMAN CDK5 regulatory subunit associated protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
4	Q8K389	0.0	2062	1822	0.591	0.614	CK5P2_MOUSE CDK5 regulatory subunit-associated protein 2 OS=Mus musculus OX=10090 GN=Cdk5rap2 PE=1 SV=3
5	Q96SN8	0.0	3851	1893	1.000	1.000	CK5P2_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=5
6	Q9JLH5	0.0	2510	1903	0.712	0.708	CK5P2_RAT CDK5 regulatory subunit-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cdk5rap2 PE=1 SV=2
7	B7ZNY0	1.05e-47	191	2412	0.096	0.075	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
8	Q5VU43	9.42e-43	175	2346	0.095	0.077	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
9	Q9WUJ3	1.09e-41	171	2324	0.091	0.074	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
10	Q80YT7	6.95e-40	166	2224	0.088	0.075	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
11	Q8TBR0	2.35e-24	103	177	0.034	0.362	Q8TBR0_HUMAN PDE4DIP protein OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=1
12	P54623	3.24e-08	61.6	1320	0.045	0.065	CNN_DROME Centrosomin OS=Drosophila melanogaster OX=7227 GN=cnn PE=1 SV=3
13	Q54RX7	0.004	44.7	1381	0.011	0.014	Q54RX7_DICDI Centrosomin N-terminal motif 1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282851 PE=4 SV=1
14	C8VIR1	0.007	43.9	1207	0.020	0.031	C8VIR1_EMENI Calmodulin-binding coil-coil protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03062 PE=4 SV=1
15	Q92351	0.007	43.9	1208	0.069	0.108	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
16	O54874	0.023	42.4	1732	0.039	0.042	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
17	Q5VT25	0.14	39.7	1732	0.040	0.043	MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA PE=1 SV=1
18	Q585H6	0.36	38.5	1692	0.026	0.029	FAZ1_TRYB2 Flagellar attachment zone protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=FAZ1 PE=4 SV=1
19	A0A8I6A5W7	0.42	38.1	1873	0.052	0.052	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
20	P46864	0.45	37.7	745	0.029	0.074	KN14M_ARATH Kinesin-like protein KIN-14M OS=Arabidopsis thaliana OX=3702 GN=KIN14M PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07989 Cnn_1N	3e-18	77.1	Centrosomin N-terminal motif 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343818

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352572	0.999	Pericentrin
2	9606.ENSP00000370337	0.995	Centrosomal protein of 152 kDa
3	9606.ENSP00000348573	0.991	A-kinase anchor protein 9
4	9606.ENSP00000371308	0.991	Centromere protein J
5	9606.ENSP00000384792	0.945	WD repeat-containing protein 62
6	9606.ENSP00000446093	0.934	Gamma-tubulin complex component 2
7	9606.ENSP00000311500	0.933	Mitotic spindle organizing protein 2A
8	9606.ENSP00000356379	0.930	Abnormal spindle-like microcephaly-associated protein
9	9606.ENSP00000360944	0.927	SCL-interrupting locus protein
10	9606.ENSP00000393963	0.919	Kinesin-like protein KIFC1
11	9606.ENSP00000257287	0.917	Centrosomal protein of 135 kDa
12	9606.ENSP00000342924	0.884	Microcephalin
13	9606.ENSP00000451211	0.880	Protein NEDD1
14	9606.ENSP00000251413	0.877	Tubulin gamma-1 chain
15	9606.ENSP00000287482	0.873	Spindle assembly abnormal protein 6 homolog
16	9606.ENSP00000300093	0.872	Serine/threonine-protein kinase PLK1
17	9606.ENSP00000336524	0.870	Centrosomal protein of 63 kDa
18	9606.ENSP00000216911	0.869	Aurora kinase A
19	9606.ENSP00000480316	0.846	Gamma-tubulin complex component 5
20	9606.ENSP00000270861	0.841	Serine/threonine-protein kinase PLK4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.953	enzyme binding
GO:1901363	0.931	heterocyclic compound binding
GO:0097159	0.931	organic cyclic compound binding
GO:0003676	0.900	nucleic acid binding
GO:0003690	0.889	double-stranded DNA binding
GO:0005516	0.858	calmodulin binding
GO:0015631	0.857	tubulin binding
GO:0019901	0.857	protein kinase binding
GO:1990837	0.855	sequence-specific double-stranded DNA binding
GO:0008017	0.847	microtubule binding
GO:0043015	0.835	gamma-tubulin binding
GO:0000976	0.736	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0044087	0.971	regulation of cellular component biogenesis
GO:0071840	0.963	cellular component organization or biogenesis
GO:0016043	0.946	cellular component organization
GO:0000226	0.927	microtubule cytoskeleton organization
GO:0010564	0.918	regulation of cell cycle process
GO:0022402	0.917	cell cycle process
GO:0033043	0.900	regulation of organelle organization
GO:0048518	0.888	positive regulation of biological process
GO:0022607	0.885	cellular component assembly
GO:0048522	0.881	positive regulation of cellular process
GO:0019222	0.857	regulation of metabolic process
GO:0070925	0.801	organelle assembly
GO:0007098	0.783	centrosome cycle
GO:0051171	0.757	regulation of nitrogen compound metabolic process
GO:0032886	0.733	regulation of microtubule-based process
GO:0060255	0.732	regulation of macromolecule metabolic process
GO:0140694	0.726	non-membrane-bounded organelle assembly
GO:0080090	0.694	regulation of primary metabolic process
GO:0031323	0.574	regulation of cellular metabolic process
GO:0051493	0.517	regulation of cytoskeleton organization
GO:0010638	0.453	positive regulation of organelle organization
GO:0051179	0.436	localization
GO:0000278	0.356	mitotic cell cycle
GO:0051298	0.343	centrosome duplication
GO:0070507	0.329	regulation of microtubule cytoskeleton organization
GO:0007059	0.325	chromosome segregation
GO:0098534	0.316	centriole assembly
GO:0007099	0.311	centriole replication
GO:0051495	0.310	positive regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.999	centrosome
GO:0005819	0.993	spindle
GO:0005829	0.987	cytosol
GO:0030054	0.983	cell junction
GO:0000922	0.914	spindle pole
GO:0012505	0.903	endomembrane system
GO:0043227	0.842	membrane-bounded organelle
GO:0099512	0.783	supramolecular fiber
GO:0099513	0.770	polymeric cytoskeletal fiber
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0005874	0.763	microtubule
GO:0032991	0.755	protein-containing complex
GO:1990752	0.613	microtubule end
GO:0005794	0.532	Golgi apparatus
GO:0005576	0.529	extracellular region
GO:0000931	0.438	gamma-tubulin ring complex
GO:1903561	0.436	extracellular vesicle
GO:0005615	0.435	extracellular space
GO:0070062	0.434	extracellular exosome
GO:0031981	0.433	nuclear lumen
GO:0048471	0.408	perinuclear region of cytoplasm
GO:0005654	0.397	nucleoplasm
GO:0035371	0.375	microtubule plus-end
GO:0000242	0.367	pericentriolar material

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]